HNRPDL Polyclonal antibody

• Home
• Products
• Primary Antibodies
• HNRPDL Polyclonal antibody (10660-2-AP)

• Featured Product
• KD/KO Validated

HNRPDL Polyclonal Antibody for WB, IHC, ELISA

Cat No. 10660-2-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

AU-rich element RNA-binding factor, Heterogeneous nuclear ribonucleoprotein D-like, HNRNP, hnRNP D like, hnRNP DL

• 

  WB analysis using 10660-2-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10660-2-AP (HNRPDL antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 10660-2-AP

  WB result of HNRPDL antibody (10660-2-AP; 1:24000; incubated at room temperature for 1.5 hours) with sh-Control and sh-HNRPDL transfected HeLa cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human intrahepatic cholangiocarcinoma using 10660-2-AP

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 10660-2-AP (HNRPDL antibody) at dilution of 1:800 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for HNRPDL in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HL-60 cells, HeLa cells, K-562 cells, mouse brain tissue, rat brain tissue
• Positive IHC detected in: human intrahepatic cholangiocarcinoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunohistochemistry (IHC): IHC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10660-2-AP targets HNRPDL in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1046

  Product name: Recombinant human HNRPDL protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 132-415 aa of BC007392

  Sequence: KINASKNQQDDGKMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKEHKLDGKLIDPKRAKALKGKEPPKKVFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRYHQIGSGKCEIKVAQPKEVYRQQQQQQKGGRGAAAGGRGGTRGRGRGQGQNWNQGFNNYYDQGYGNYNSAYGGDQNYSGYGGYDYTGYNYGNYGYGQGYADYSGQQSTYGKASRGGGNHQNNYQPY

• Full Name: heterogeneous nuclear ribonucleoprotein D-like
• Calculated Molecular Weight: 46.4 kDa
• Observed Molecular Weight: 38-40 kDa
• GenBank Accession Number: BC007392
• Gene Symbol: HNRPDL
• Gene ID (NCBI): 9987
• RRID: AB_2120666
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O14979
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The HNRPDL Polyclonal antibody (Cat# 10660-2-AP) has 2 citations. One appears in Nature Communications (2025), where it was used for immunofluorescence in an integrated transcriptomic and proteomic mapping study of the mouse hippocampus at synaptic resolution. The other is in Cell Biochemistry and Function, where it was applied in WB and IHC to investigate JKTBP1-induced androgen-independent LNCaP cell proliferation via EGF-R activation. The associated research fields are neuroscience/synaptic biology and cancer biology.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	Nat Commun; An integrated transcriptomic and proteomic map of the mouse hippocampus at synaptic resolution.; Authors - Eva Kaulich
human	WB,IHC	Cell Biochem Funct; Overexpression of JKTBP1 induces androgen-independent LNCaP cell proliferation through activation of epidermal growth factor-receptor (EGF-R).; Authors - Yong-Yang Wu