HNRPDL Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 83129-5-RR (same clone as 83129-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83129-5-RR (HNRPDL antibody) at dilution of 1:15000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83129-5-PBS in a different storage buffer formulation.

• 

  IF Staining of U-251 using 83129-5-RR (same clone as 83129-5-PBS)

  Immunofluorescent analysis of (4% PFA) fixed U-251 cells using HNRPDL antibody (83129-5-RR, Clone: 230415F9 ) at dilution of 1:1000 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 83129-5-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 83129-5-RR (same clone as 83129-5-PBS)

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug HNRPDL Recombinant antibody (83129-5-RR, Clone:230415F9) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug rabbit IgG isotype control (blue). Cells were fixed and permeabilized with True-Nuclear Transcription Factor Buffer Set. This data was developed using the same antibody clone with 83129-5-PBS in a different storage buffer formulation.

HNRPDL Uni-rAb^® Recombinant Antibody for WB, IF/ICC, FC (Intra), Indirect ELISA

Cat No. 83129-5-PBS

Clone No.230415F9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, FC (Intra), Indirect ELISA

Synonyms

230415F9, AU-rich element RNA-binding factor, Heterogeneous nuclear ribonucleoprotein D-like, HNRNP, hnRNP D like

---

Product Information

83129-5-PBS targets HNRPDL in WB, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1046

  Product name: Recombinant human HNRPDL protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 130-415 aa of BC007392

  Sequence: GSKINASKNQQDDGKMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKEHKLDGKLIDPKRAKALKGKEPPKKVFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRYHQIGSGKCEIKVAQPKEVYRQQQQQQKGGRGAAAGGRGGTRGRGRGQGQNWNQGFNNYYDQGYGNYNSAYGGDQNYSGYGGYDYTGYNYGNYGYGQGYADYSGQQSTYGKASRGGGNHQNNYQPY

• Full Name: heterogeneous nuclear ribonucleoprotein D-like
• Calculated Molecular Weight: 46 aa, 4 kDa
• GenBank Accession Number: BC007392
• Gene Symbol: HNRPDL
• Gene ID (NCBI): 9987
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: O14979
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.