Mouse HO-1/Hmox1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 83291-3-RR (same clone as 83291-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83291-3-RR (HO-1/Hmox1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83291-3-PBS in a different storage buffer formulation.

• 

  WB analysis using 83291-3-RR (same clone as 83291-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83291-3-RR (HO-1/Hmox1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83291-3-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse spleen using 83291-3-RR (same clone as 83291-3-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 83291-3-RR (HO-1/Hmox1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83291-3-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse spleen using 83291-3-RR (same clone as 83291-3-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 83291-3-RR (HO-1/Hmox1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83291-3-PBS in a different storage buffer formulation.

• 

  FC experiment of NIH/3T3 using 83291-3-RR (same clone as 83291-3-PBS)

  1x10^6 NIH/3T3 cells were intracellularly stained with 0.25 ug HO-1/Hmox1 Recombinant antibody (83291-3-RR, Clone:240236G4) and PE-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 83291-3-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83291-3-RR

  Biolayer interferometry (BLl) kinetic assays of 83291-3-RR against Mouse HO-1/Hmox1 were performed. The affinity constant is 1.23 nM.

HO-1/Hmox1 Uni-rAb^® Recombinant Antibody for WB, IHC, FC (Intra), Indirect ELISA

Cat No. 83291-3-PBS

Clone No.240236G4

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, IHC, FC (Intra), Indirect ELISA

Synonyms

Hmox1, HO-1, 240236G4, D8Wsu38e, heme oxygenase (decycling) 1

---

Product Information

83291-3-PBS targets HO-1/Hmox1 in WB, IHC, FC (Intra), Indirect ELISA applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0938

  Product name: Recombinant mouse HO-1/Hmox1 protein

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 1-266 aa of NM_010442.2

  Sequence: MERPQPDSMPQDLSEALKEATKEVHIQAENAEFMKNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQNPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEIIPCTPATQHYVKRLHEVGRTHPELLVAHAYTRYLGDLSGGQVLKKIAQKAMALPSSGEGLAFFTFPNIDSPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLNIELFEELQVMLTEEHKDQSPSQMASLRQRPASLVQDTAPAETPRGKPQISTSSSQT

• Full Name: heme oxygenase (decycling) 1
• Calculated Molecular Weight: 33 kDa
• Observed Molecular Weight: 33 kDa
• GenBank Accession Number: NM_010442.2
• Gene Symbol: HO-1
• Gene ID (NCBI): 15368
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P14901
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.