HOPX Recombinant monoclonal antibody, PBS Only (Detector)

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• HOPX Recombinant monoclonal antibody, PBS Only (Detector) (89193-1-PBS)

HOPX Uni-rAb^® Recombinant Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA

Cat No. 89193-1-PBS Copied!

Clone No. 262110B4

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA

Synonyms

• 

  Sandwich ELISA sample test of MP03796-1

  The mean HOPX concentration was determined to be 6.84 ng/mL in RT-4 cell extract based on a 1.2 mg/mL extract load, 1.43 ng/mL in k-562 cell extract based on a 1.2 mg/mL extract load and 2.19 ng/mL in THP-1 cell extract based on a 1.2 mg/mL extract load.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Sandwich ELISA standard curve of MP03796-1

  Sandwich ELISA standard curve of MP03796-1, Human HOPX Recombinant Matched Antibody Pair - PBS only. 89193-2-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag1979. 89193-1-PBS was HRP conjugated as the detection antibody. Range: 78.1-5000 pg/mL

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Cytometric bead array sample test of MP03796-1

  The mean HOPX concentration was determined to be 4.7 ng/mL in RT-4 cell extract based on a 1.2 mg/mL extract load, THP-1 cell extract were served as a negative control.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Cytometric bead array standard curve of MP03796-1

  Cytometric bead array standard curve of MP03796-1, HOPX Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 89193-2-PBS. Detection antibody: 89193-1-PBS. Standard: Ag1979. Range: 0.156-20 ng/mL.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for HOPX in ?

Chat with Able

---

Product Information

89193-1-PBS targets HOPX as part of a matched antibody pair:

MP03796-1: 89193-2-PBS capture and 89193-1-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1979

  Product name: Recombinant human HOPX protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-73 aa of BC014225

  Sequence: MSAETASGPTEDQVEILEYNFNKVDKHPDSTTLCLIAAEAGLSEEETQKWFKQRLAKWRRSEGLPSECRSVID

• Full Name: HOP homeobox
• Calculated Molecular Weight: 73 aa, 8 kDa
• GenBank Accession Number: BC014225
• Gene Symbol: HOPX
• Gene ID (NCBI): 84525
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9BPY8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.