HOXA10 Polyclonal antibody

• 

  WB analysis of HEK-293 using 26497-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 26497-1-AP (HOXA10 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 26497-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 26497-1-AP (HOXA10 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• Featured Product
• KD/KO Validated

HOXA10 Polyclonal Antibody for WB, ELISA

Cat No. 26497-1-AP

Publications(12)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (3)

Applications

WB, IHC, IF, ELISA

Synonyms

homeobox A10, Homeobox protein Hox 1.8, Homeobox protein Hox 1H, Homeobox protein Hox A10, HOX1, HOX1.8, HOX1H, HOXA10, PL

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 12 publications below
• IHC: See 3 publications below
• IF: See 2 publications below

Product Information

26497-1-AP targets HOXA10 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, monkey, bovine
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24156

  Product name: Recombinant human HOXA10 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 203-311 aa of BC013971

  Sequence: YGTAKGYGSGGGGAQQLGAGPFPAQPPGRGFDLPPALASGSADAARKERALDSPPPPTLACGSGGGSQGDEEAHASSSAAEELSPAPSESSKASPEKDSLGNSKGENAA

• Full Name: homeobox A10
• Calculated Molecular Weight: 393 aa, 41 kDa
• Observed Molecular Weight: 45-50 kDa
• GenBank Accession Number: BC013971
• Gene Symbol: HOXA10
• Gene ID (NCBI): 3206
• RRID: AB_2880533
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P31260
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HOXA10, also named as Homeobox protein Hox-A10, is a 410 amino acid protein, which contains 1 homeobox DNA-binding domain and belongs to the Abd-B homeobox family. HOXA10 localizes in the nucleus and can Interacts with SIRT2. HOXA10 as sequence-specific transcription factor, is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. HoxA10 expression increases during the midsecretory phase of the menstrual cycle, which corresponds with increased levels of circulating progesterone.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Front Med; Knockdown of RFC4 inhibits the cell proliferation of nasopharyngeal carcinoma in vitro and in vivo; Authors - Shuzhen Guan
human	WB,IHC,IF	Mol Cancer; LncHOXA10 drives liver TICs self-renewal and tumorigenesis via HOXA10 transcription activation.; Authors - Ming Shao ; KO Validated
human	WB	Sci Rep; Developmental exposure to perfluorooctane sulfonate(PFOS) impairs the endometrial receptivity; Authors - Rui Ren
human	WB	Biochem Biophys Res Commun; Role of PRMT5 mediated HOXA10 arginine 337 methylation in endometrial epithelial cell receptivity; Authors - Zhiwen Cao
human	WB,IHC	Reprod Biol Endocrinol; Characterization of VDR and CYP27B1 expression in the endometrium during the menstrual cycle before embryo transfer: implications for endometrial receptivity.; Authors - Jing Guo
monkey	WB	J Assist Reprod Genet; Long-term effects of repeated superovulation on the uterus and mammary gland in rhesus monkeys.; Authors - Peipei Yan