HOXA2 Polyclonal antibody

• 

  WB analysis of HepG2 using 25044-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 25044-1-AP (HOXA2 Antibody) at dilution of 1:600 incubated at 4 degree celsius over night.

• 

  WB analysis of Jurkat using 25044-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 25044-1-AP (HOXA2 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of C6 using 25044-1-AP

  C6 cells were subjected to SDS PAGE followed by western blot with 25044-1-AP (HOXA2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

HOXA2 Polyclonal Antibody for WB, ELISA

Cat No. 25044-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, ELISA

Synonyms

homeobox A2, Homeobox protein Hox 1K, Homeobox protein Hox A2, HOX1K, HOXA2

---

Tested Applications

• Positive WB detected in: HepG2 cells, C6 cells, Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

25044-1-AP targets HOXA2 in WB, ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19224

  Product name: Recombinant human HOXA2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 256-340 aa of BC130571

  Sequence: LSQQQAPNGHNGDSQSFPVSPLTSNEKNLKHFQHQSPTVPNCLSTMGQNCGAGLNNDSPEALEVPSLQDFSVFSTDSCLQLSDAV

• Full Name: homeobox A2
• Calculated Molecular Weight: 376 aa, 41 kDa
• Observed Molecular Weight: 41-43 kDa
• GenBank Accession Number: BC130571
• Gene Symbol: HOXA2
• Gene ID (NCBI): 3199
• RRID: AB_2879868
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43364
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HOXA2, also named as Homeobox protein Hox-A2, is a 376 amino acid protein, which contains 1 homeobox DNA-binding domain and belongs to the Antp homeobox family. HOXA2 localizes in the nucleus and hsa an association with Microtia, hearing impairment, and cleft palate. HOXA2 as a sequence-specific transcription factor is part of a developmental regulatory system, which provides cells with specific positional identities on the anterior-posterior axis.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Signal; NSD2-mediated H3K36me2 exacerbates osteoporosis via activation of hoxa2 in bone marrow mesenchymal stem cells; Authors - Guanghui He