Tested Applications
| Positive WB detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
25044-1-AP targets HOXA2 in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag19224 Product name: Recombinant human HOXA2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 256-340 aa of BC130571 Sequence: LSQQQAPNGHNGDSQSFPVSPLTSNEKNLKHFQHQSPTVPNCLSTMGQNCGAGLNNDSPEALEVPSLQDFSVFSTDSCLQLSDAV Predict reactive species |
| Full Name | homeobox A2 |
| Calculated Molecular Weight | 376 aa, 41 kDa |
| Observed Molecular Weight | 41-43 kDa |
| GenBank Accession Number | BC130571 |
| Gene Symbol | HOXA2 |
| Gene ID (NCBI) | 3199 |
| RRID | AB_2879868 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O43364 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
HOXA2, also named as Homeobox protein Hox-A2, is a 376 amino acid protein, which contains 1 homeobox DNA-binding domain and belongs to the Antp homeobox family. HOXA2 localizes in the nucleus and hsa an association with Microtia, hearing impairment, and cleft palate. HOXA2 as a sequence-specific transcription factor is part of a developmental regulatory system, which provides cells with specific positional identities on the anterior-posterior axis.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for HOXA2 antibody 25044-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The HOXA2 Polyclonal antibody (Cat# 25044-1-AP) has 1 citation to date. It was cited in Cell Signaling (2024) in a study investigating NSD2-mediated H3K36me2 and its role in exacerbating osteoporosis through HOXA2 activation in bone marrow mesenchymal stem cells. The cited application was Western blot in human samples, placing the research field in epigenetics and bone biology.
| Species | Application | Title |
|---|---|---|
Cell Signal NSD2-mediated H3K36me2 exacerbates osteoporosis via activation of hoxa2 in bone marrow mesenchymal stem cells |
Reviews
What customers say
The single available review rates the antibody 4 out of 5 stars. The reviewer used it for immunofluorescence at a 1:100 dilution and noted that while the antibody is not validated for IHC, their results suggest it may work in that application with proper blocking/permeabilization optimization and appropriate organoid age tissue. Overall, the feedback is cautiously positive, indicating potential beyond the tested application.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Asimenia (Verified Customer) (09-09-2026) | The antibody hasn't been validated for the assay I wanted to use it for, which is IHC, but based on my results I believe it might work with some blocking/permeabilization optimization as well as appropriate organoid age tissue.
|
