HOXA6 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• HOXA6 Polyclonal antibody (18210-1-AP)

• Featured Product
• KD/KO Validated

HOXA6 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 18210-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF, ELISA

Synonyms

Homeobox protein Hox-1B, Homeobox protein Hox-A6, HOX1, HOX1.2, HOX1B

• 

  WB analysis of mouse brain using 18210-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 18210-1-AP (HOXA6 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 18210-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 18210-1-AP (HOXA6 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 18210-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 18210-1-AP (HOXA6 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 18210-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 18210-1-AP (HOXA6 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human brain using 18210-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 18210-1-AP (HOXA6 antibody) at dilution of 1:1000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human brain using 18210-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 18210-1-AP (HOXA6 antibody) at dilution of 1:1000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: mouse brain tissue
• Positive IHC detected in: human brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

18210-1-AP targets HOXA6 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12875

  Product name: Recombinant human HOXA6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-233 aa of BC104915

  Sequence: MSSYFVNPTFPGSLPSGQDSFLGQLPLYQAGYDALRPFPASYGASSLPDKTYTSPCFYQQSNSVLACNRASYEYGASCFYSDKDLSGASPSGSGKQRGPGDYLHFSPEQQYKPDSSSGQGKALHDEGADRKYTSPVYPWMQRMNSCAGAVYGSHGRRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKENKLINSTQPSGEDSEAKAGE

• Full Name: homeobox A6
• Calculated Molecular Weight: 233 aa, 26 kDa
• Observed Molecular Weight: 26 kDa
• GenBank Accession Number: BC104915
• Gene Symbol: HOXA6
• Gene ID (NCBI): 3203
• RRID: AB_2878518
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P31267
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC,IF	Aging (Albany NY); Coexpression of HOXA6 and PBX2 promotes metastasis in gastric cancer.; Authors - Jianjiao Lin ; KD Validated
human	WB	J Cell Mol Med; DDR1 Targeting HOXA6 Facilitates Bladder Cancer Progression via Inhibiting Ferroptosis; Authors - Xin Xie