HOXA6 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• HOXA6 Polyclonal antibody (18210-1-AP)

• Featured Product
• KD/KO Validated

HOXA6 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 18210-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF, ELISA

Synonyms

Homeobox protein Hox-1B, Homeobox protein Hox-A6, HOX1, HOX1.2, HOX1B

• 

  WB analysis of mouse brain using 18210-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 18210-1-AP (HOXA6 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 18210-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 18210-1-AP (HOXA6 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 18210-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 18210-1-AP (HOXA6 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 18210-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 18210-1-AP (HOXA6 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human brain using 18210-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 18210-1-AP (HOXA6 antibody) at dilution of 1:1000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human brain using 18210-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 18210-1-AP (HOXA6 antibody) at dilution of 1:1000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for HOXA6 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse brain tissue
• Positive IHC detected in: human brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

18210-1-AP targets HOXA6 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12875

  Product name: Recombinant human HOXA6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-233 aa of BC104915

  Sequence: MSSYFVNPTFPGSLPSGQDSFLGQLPLYQAGYDALRPFPASYGASSLPDKTYTSPCFYQQSNSVLACNRASYEYGASCFYSDKDLSGASPSGSGKQRGPGDYLHFSPEQQYKPDSSSGQGKALHDEGADRKYTSPVYPWMQRMNSCAGAVYGSHGRRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKENKLINSTQPSGEDSEAKAGE

• Full Name: homeobox A6
• Calculated Molecular Weight: 233 aa, 26 kDa
• Observed Molecular Weight: 26 kDa
• GenBank Accession Number: BC104915
• Gene Symbol: HOXA6
• Gene ID (NCBI): 3203
• RRID: AB_2878518
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P31267
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The HOXA6 Polyclonal antibody (Cat# 18210-1-AP) has 2 total citations. These appear in Aging (Albany NY) and J Cell Mol Med. The associated research fields include gastric cancer metastasis (coexpression of HOXA6 and PBX2) and bladder cancer progression via ferroptosis inhibition (DDR1 targeting HOXA6). Both studies utilized human samples, with applications including WB, IHC, and IF.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC,IF	Aging (Albany NY); Coexpression of HOXA6 and PBX2 promotes metastasis in gastric cancer.; Authors - Jianjiao Lin ; KD Validated
human	WB	J Cell Mol Med; DDR1 Targeting HOXA6 Facilitates Bladder Cancer Progression via Inhibiting Ferroptosis; Authors - Xin Xie