HOXB4 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• HOXB4 Polyclonal antibody (22256-1-AP)

HOXB4 Polyclonal Antibody for WB, ELISA

Cat No. 22256-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, ELISA

Synonyms

Homeobox protein Hox B4, Homeobox protein Hox-2.6, Homeobox protein Hox-2F, Homeobox protein Hox-B4, HOX2.6

• 

  WB analysis using 22256-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 22256-1-AP (HOXB4 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Jurkat using 22256-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 22256-1-AP (HOXB4 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for HOXB4 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Jurkat cells, SKOV-3 cells, THP-1 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

22256-1-AP targets HOXB4 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17761

  Product name: Recombinant human HOXB4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 22-72 aa of BC049204

  Sequence: EYSQSDYLPSDHSPGYYAGGQRRESSFQPEAGFGRRAACTVQRYAACRDPG

• Full Name: homeobox B4
• Calculated Molecular Weight: 251 aa, 28 kDa
• Observed Molecular Weight: 28-35 kDa
• GenBank Accession Number: BC049204
• Gene Symbol: HOXB4
• Gene ID (NCBI): 3214
• RRID: AB_2879050
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P17483
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The HOXB4 Polyclonal antibody (Cat# 22256-1-AP) has 1 citation to date. It was cited in Molecular Carcinogenesis (2025), in a study investigating how circ_0044362 promotes epithelial ovarian cancer progression by enhancing HOXB4 transcription to activate the RUNX1/IGFBP3 axis. The research field is oncology, specifically ovarian cancer molecular mechanisms and circRNA-mediated gene regulation. The antibody was used for Western blot in both human and mouse samples.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,human	WB	Mol Carcinog; Circ_0044362 Facilitates the Progression of Epithelial Ovarian Cancer via Enhancing HOXB4 Transcription to Activate the RUNX1/IGFBP3 Axis; Authors - Shengtou Ye ; KD Validated