HOXB8 Polyclonal antibody

• 

  WB analysis using 31387-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31387-1-AP (HOXB8 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 31387-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31387-1-AP (HOXB8 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

HOXB8 Polyclonal Antibody for WB, ELISA

Cat No. 31387-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

Hox 2.4, HOX2D

---

Tested Applications

• Positive WB detected in: mouse kidney tissue, HCT 116 cells, HT-29 cells, LoVo cells, mouse epididymis tissue, rat kidney tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31387-1-AP targets HOXB8 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34946

  Product name: Recombinant human HOXB8 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 15-134 aa of NM_024016

  Sequence: TGESLRPNYYDCGFAQDLGGRPTVVYGPSSGGSFQHPSQIQEFYHGPSSLSTAPYQQNPCAVACHGDPGNFYGYDPLQRQSLFGAQDPDLVQYADCKLAAASGLGEEAEGSEQSPSPTQL

• Full Name: homeobox B8
• Calculated Molecular Weight: 28 kDa
• Observed Molecular Weight: 31 kDa
• GenBank Accession Number: NM_024016
• Gene Symbol: HOXB8
• Gene ID (NCBI): 3218
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P17481
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HOXB8, also known as homeobox B8, is a member of the homeobox family. HOXB8 plays a role in the regulation of embryonic development. It helps determine the identity and differentiation of cells along the anterior-posterior axis of the body. ncreased expression of HOXB8 is associated with colorectal cancer. It has been found to enhance the proliferation and metastasis of colorectal cancer cells by promoting epithelial-mesenchymal transition (EMT) via STAT3 activation (PMID: 30622439).