HOXB9 Recombinant monoclonal antibody, PBS Only

HOXB9 Uni-rAb® Recombinant Antibody for WB, Indirect ELISA
Cat No. 84609-3-PBS
Clone No.241866C6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

HOX2E, HOX2.5, Homeobox protein Hox-B9, Homeobox protein Hox-2E, Homeobox protein Hox-2.5

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84609-3-PBS targets HOXB9 in WB, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag34837

Product name: Recombinant human HOXB9 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-202 aa of BC015565

Sequence: MSISGTLSSYYVDSIISHESEDAPPAKFPSGQYASSRQPGHAEHLEFPSCSFQPKAPVFGASWAPLSPHASGSLPSVYHPYIQPQGVPPAESRYLRTWLEPAPRGEAAPGQGQAAVKAEPLLGAPGELLKQGTPEYSLETSAGREAVLSNQRPGYGDNKICEGSEDKERPDQTNPSANWLHARSSRKKRCPYTKYQTLELEK

Predict reactive species
Full Name homeobox B9
Calculated Molecular Weight 250 aa, 28 kDa
Observed Molecular Weight30 kDa
GenBank Accession NumberBC015565
Gene Symbol HOXB9
Gene ID (NCBI) 3219
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP17482
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

HOXB9 is a member of the Homeobox (HOX) gene family, which plays a crucial role in embryonic development and is involved in the regulation of gene expression during this process. In addition to its role in embryogenesis, HOXB9 has been implicated in various cancers, including breast and prostate cancer. It is overexpressed in breast cancer tissue and is regulated by estrogen, playing a critical role in angiogenesis. HOXB9 overexpression has been shown to stimulate three-dimensional colony formation in soft-agar assays, indicating its role in tumorigenesis. Furthermore, HOXB9 binds to the promoters of various tumor growth and angiogenic factors, regulating their expression, and its homeodomain plays a crucial role in transcriptional regulation and tumorigenesis.

Loading...
||
New chat Able
正在加载,请稍候...