HOXD4 Polyclonal antibody

• 

  WB analysis of A549 using 17780-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 17780-1-AP (HOXD4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

HOXD4 Polyclonal Antibody for WB, ELISA

Cat No. 17780-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

HHO.C13, Homeobox protein Hox-4B, Homeobox protein Hox-5.1, Homeobox protein Hox-D4, HOX4B

---

Tested Applications

• Positive WB detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

17780-1-AP targets HOXD4 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11134

  Product name: Recombinant human HOXD4 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-255 aa of BC016763

  Sequence: MVMSSYMVNSKYVDPKFPPCEEYLQGGYLGEQGADYYGGGAQGADFQPPGLYPRPDFGEQPFGGSGPGPGSALPARGHGQEPGGPGGHYAAPGEPCPAPPAPPPAPLPGARAYSQSDPKQPPSGTALKQPAVVYPWMKKVHVNSVNPNYTGGEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQIKIWFQNRRMKWKKDHKLPNTKGRSSSSSSSSSCSSSVAPSQHLQPMAKDHHTDLTTL

• Full Name: homeobox D4
• Calculated Molecular Weight: 28 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC016763
• Gene Symbol: HOXD4
• Gene ID (NCBI): 3233
• RRID: AB_2878440
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P09016
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.