HOXD4 Polyclonal antibody

• 

  WB analysis of A549 using 17780-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 17780-1-AP (HOXD4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

HOXD4 Polyclonal Antibody for WB, ELISA

Cat No. 17780-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

HHO.C13, homeobox D4, Homeobox protein HHO.C13, Homeobox protein Hox 4B, Homeobox protein Hox 5.1, Homeobox protein Hox D4, Hox 4.2, HOX 5.1, HOX4, HOX4B, HOXD4

---

Tested Applications

• Positive WB detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

17780-1-AP targets HOXD4 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11134

  Product name: Recombinant human HOXD4 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-255 aa of BC016763

  Sequence: MVMSSYMVNSKYVDPKFPPCEEYLQGGYLGEQGADYYGGGAQGADFQPPGLYPRPDFGEQPFGGSGPGPGSALPARGHGQEPGGPGGHYAAPGEPCPAPPAPPPAPLPGARAYSQSDPKQPPSGTALKQPAVVYPWMKKVHVNSVNPNYTGGEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQIKIWFQNRRMKWKKDHKLPNTKGRSSSSSSSSSCSSSVAPSQHLQPMAKDHHTDLTTL

• Full Name: homeobox D4
• Calculated Molecular Weight: 28 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC016763
• Gene Symbol: HOXD4
• Gene ID (NCBI): 3233
• RRID: AB_2878440
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P09016
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.