HOXD8 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• HOXD8 Polyclonal antibody (18588-1-AP)

HOXD8 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 18588-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

Homeobox protein Hox-4E, Homeobox protein Hox-5.4, Homeobox protein Hox-D8, HOX4E

• 

  WB analysis of A375 using 18588-1-AP

  A375 cells were subjected to SDS PAGE followed by western blot with 18588-1-AP (HOXD8 Antibody) at dilution of 1:300 incubated at 4 degree celsius over night.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 18588-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 18588-1-AP (HOXD8 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 18588-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 18588-1-AP (HOXD8 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A375 using 18588-1-AP

  A375 cells were subjected to SDS PAGE followed by western blot with 18588-1-AP (HOXD8 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse kidney using 18588-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 18588-1-AP (HOXD8 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human renal cell carcinoma using 18588-1-AP

  Immunohistochemical analysis of paraffin-embedded human renal cell carcinoma tissue slide using 18588-1-AP (HOXD8 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat kidney using 18588-1-AP

  Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 18588-1-AP (HOXD8 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for HOXD8 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A375 cells, HEK-293 cells, HeLa cells
• Positive IHC detected in: human renal cell carcinoma tissue, mouse kidney tissue, rat kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

18588-1-AP targets HOXD8 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13245

  Product name: Recombinant human HOXD8 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-289 aa of BC038709

  Sequence: MSSYFVNPLYSKYKAAAAAAAAAGEAINPTYYDCHFAPEVGGRHAAAAAALQLYGNSAAGFPHAPPQAHAHPHPSPPPSGTGCGGREGRGQEYFHPGGGSPAAAYQAAPPPPPHPPPPPPPPPCGGIACHGEPAKFYGYDNLQRQPIFTTQQEAELVQYPDCKSSSGNIGEDPDHLNQSSSPSQMFPWMRPQAPGRRRGRQTYSRFQTLELEKEFLFNPYLTRKRRIEVSHALALTERQVKIWFQNRRMKWKKENNKDKFPVSRQEVKDGETKKEAQELEEDRAEGLTN

• Full Name: homeobox D8
• Calculated Molecular Weight: 32 kDa
• Observed Molecular Weight: 32 kDa
• GenBank Accession Number: BC038709
• Gene Symbol: HOXD8
• Gene ID (NCBI): 3234
• RRID: AB_2878554
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P13378
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The HOXD8 Polyclonal antibody (Cat# 18588-1-AP) has 1 citation to date. It was cited in Experimental Cell Research (2025), in a study investigating how HOXD8 drives glioma progression through epithelial-mesenchymal transition regulation, with implications for prognosis and targeted therapy. The research field encompasses neuro-oncology and cancer biology, specifically glioma and EMT signaling.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Exp Cell Res; HOXD8 Drives Glioma Progression through Epithelial-Mesenchymal Transition Regulation: Implications for Prognosis and Targeted Therapy; Authors - Ke Yu