HOXD8 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• HOXD8 Polyclonal antibody, PBS Only (18588-1-PBS)

• 

  WB analysis of A375 using 18588-1-AP (same clone as 18588-1-PBS)

  A375 cells were subjected to SDS PAGE followed by western blot with 18588-1-AP (HOXD8 Antibody) at dilution of 1:300 incubated at 4 degree celsius over night. This data was developed using the same antibody clone with 18588-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A375 using 18588-1-AP (same clone as 18588-1-PBS)

  A375 cells were subjected to SDS PAGE followed by western blot with 18588-1-AP (HOXD8 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18588-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 18588-1-AP (same clone as 18588-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 18588-1-AP (HOXD8 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18588-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 18588-1-AP (same clone as 18588-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 18588-1-AP (HOXD8 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18588-1-PBS in a different storage buffer formulation.

HOXD8 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 18588-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

Homeobox protein Hox-4E, Homeobox protein Hox-5.4, Homeobox protein Hox-D8, HOX4E

---

Product Information

18588-1-PBS targets HOXD8 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13245

  Product name: Recombinant human HOXD8 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-289 aa of BC038709

  Sequence: MSSYFVNPLYSKYKAAAAAAAAAGEAINPTYYDCHFAPEVGGRHAAAAAALQLYGNSAAGFPHAPPQAHAHPHPSPPPSGTGCGGREGRGQEYFHPGGGSPAAAYQAAPPPPPHPPPPPPPPPCGGIACHGEPAKFYGYDNLQRQPIFTTQQEAELVQYPDCKSSSGNIGEDPDHLNQSSSPSQMFPWMRPQAPGRRRGRQTYSRFQTLELEKEFLFNPYLTRKRRIEVSHALALTERQVKIWFQNRRMKWKKENNKDKFPVSRQEVKDGETKKEAQELEEDRAEGLTN

• Full Name: homeobox D8
• Calculated Molecular Weight: 32 kDa
• Observed Molecular Weight: 32 kDa
• GenBank Accession Number: BC038709
• Gene Symbol: HOXD8
• Gene ID (NCBI): 3234
• RRID: AB_2878554
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P13378
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.