HP Monoclonal antibody, PBS Only (Detector)

• 

  Sandwich ELISA standard curve of MP50036-1

  Sandwich ELISA standard curve of MP50036-1, Haptoglobin Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 68682-1-PBS. Detection antibody: 68682-2-PBS. Standard: Eg0445. Range: 62.5-4000 pg/mL.

• 

  Sample test of MP50036-1

  Serum of sixteen individual healthy human donors was measured. The Haptoglobin concentration of detected samples was determined to be 658.6 μg/mL with a range of 0.6 -2,265.0 μg/mL.

• 

  Sample test of MP50036-1

  Saliva of eight individual healthy human donors was measured. The Haptoglobin concentration of detected samples was determined to be 149.8 ng/mL with a range of 11.6-284.1 ng/mL.

• 

  Sample test of MP50036-1

  Urine of sixteen individual healthy human donors was measured. The Haptoglobin concentration of detected samples was determined to be 42.8 ng/mL with a range of 0.2-198.3 ng/mL.

• 

  Sample test of MP50036-1

  HepG2 cells were cultured in serum-free DMEM supplemented with 2.5 mM L-glutamine, 100 U/mL penicillin, and 100 μg/mL streptomycin sulfate. An aliquot of the cell culture supernate was removed at 3 days, assayed for human Haptoglobin, and measured 10.8 ng/mL.

HP Monoclonal Antibody for Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 68682-2-PBS

Clone No.3B3G4

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

haptoglobin, BP, HAPT, HP2 ALPHA 2, HPA1S

---

Product Information

68682-2-PBS targets HP as part of a matched antibody pair:

MP50036-1: 68682-1-PBS capture and 68682-2-PBS detection (validated in Sandwich ELISA)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg0445

  Product name: Recombinant Human Haptoglobin/HP protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 19-406 aa of BC121125

  Sequence: VDSGNDVTDIADDGCPKPPEIAHGYVEHSVRYQCKNYYKLRTEGDGVYTLNDKKQWINKAVGDKLPECEADDGCPKPPEIAHGYVEHSVRYQCKNYYKLRTEGDGVYTLNNEKQWINKAVGDKLPECEAVCGKPKNPANPVQRILGGHLDAKGSFPWQAKMVSHHNLTTGATLINEQWLLTTAKNLFLNHSENATAKDIAPTLTLYVGKKQLVEIEKVVLHPNYSQVDIGLIKLKQKVSVNERVMPICLPSKDYAEVGRVGYVSGWGRNANFKFTDHLKYVMLPVADQDQCIRHYEGSTVPEKKTPKSPVGVQPILNEHTFCAGMSKYQEDTCYGDAGSAFAVHDLEEDTWYATGILSFDKSCAVAEYGVYVKVTSIQDWVQKTIAEN

• Full Name: haptoglobin
• GenBank Accession Number: BC121125
• Gene Symbol: HP
• Gene ID (NCBI): 3240
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P00738
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.