HP Recombinant monoclonal antibody, PBS Only (Detector)

• 

  Sandwich ELISA sample test of MP00779-1

  Saliva of eight individual healthy human donors was measured. The Haptoglobin concentration of detected samples was determined to be 199.6 ng/mL with a range of 14.0 - 624.8 ng/mL.

• 

  Sandwich ELISA sample test of MP00779-1

  Urine of seven individual healthy human donors was measured. The Haptoglobin concentration of detected samples was determined to be 18.3 ng/mL with a range of 2.7 - 41.0 ng/mL.

• 

  Sandwich ELISA sample test of MP00779-1

  Serum of sixteen individual healthy human donors was measured. The Haptoglobin concentration of detected samples was determined to be 1.6 mg/mL with a range of 0.3-5.4 mg/mL.

• 

  Sandwich ELISA standard curve of MP00779-1

  Sandwich ELISA standard curve of MP00779-1, Human Haptoglobin Recombinant Matched Antibody Pair - PBS only. 82812-8-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Eg0445. 82812-2-PBS was HRP conjugated as the detection antibody. Range: 46.9-3000 pg/mL.

HP Uni-rAb^® Recombinant Antibody for Sandwich ELISA, Indirect ELISA

Cat No. 82812-2-PBS

Clone No.3J2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Sandwich ELISA, Indirect ELISA

Synonyms

---

Product Information

82812-2-PBS targets HP as part of a matched antibody pair:

MP00779-1: 82812-8-PBS capture and 82812-2-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0445

  Product name: Recombinant Human Haptoglobin/HP protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 19-406 aa of BC121125

  Sequence: VDSGNDVTDIADDGCPKPPEIAHGYVEHSVRYQCKNYYKLRTEGDGVYTLNDKKQWINKAVGDKLPECEADDGCPKPPEIAHGYVEHSVRYQCKNYYKLRTEGDGVYTLNNEKQWINKAVGDKLPECEAVCGKPKNPANPVQRILGGHLDAKGSFPWQAKMVSHHNLTTGATLINEQWLLTTAKNLFLNHSENATAKDIAPTLTLYVGKKQLVEIEKVVLHPNYSQVDIGLIKLKQKVSVNERVMPICLPSKDYAEVGRVGYVSGWGRNANFKFTDHLKYVMLPVADQDQCIRHYEGSTVPEKKTPKSPVGVQPILNEHTFCAGMSKYQEDTCYGDAGSAFAVHDLEEDTWYATGILSFDKSCAVAEYGVYVKVTSIQDWVQKTIAEN

• Full Name: haptoglobin
• GenBank Accession Number: BC121125
• Gene Symbol: HP
• Gene ID (NCBI): 3240
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P00738
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.