Tested Applications
| Positive WB detected in | SH-SY5Y cells, HeLa cells, mouse brain tissue, rat brain tissue, human brain tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | human kidney tissue, mouse cerebellum tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10989-1-AP targets VILIP3 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1449 Product name: Recombinant human HPCA protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-193 aa of BC009846 Sequence: MGKQNSKLRPEVLQDLRENTEFTDHELQEWYKGFLKDCPTGHLTVDEFKKIYANFFPYGDASKFAEHVFRTFDTNGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISRSEMLEIVQAIYKMVSSVMKMPEDESTPEKRTDKIFRQMDTNNDGKLSLEEFIRGAKSDPSIVRLLQCDPSSASQF Predict reactive species |
| Full Name | hippocalcin-like 1 |
| Calculated Molecular Weight | 22 kDa |
| Observed Molecular Weight | 22 kDa |
| GenBank Accession Number | BC009846 |
| Gene Symbol | VILIP3 |
| Gene ID (NCBI) | 3241 |
| RRID | AB_2120220 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P37235 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
VILIP3, is a member of neuron-specific calcium-binding proteins family found in the retina and brain. It is highly similar to human hippocalcin protein and nearly identical to the rat and mouse hippocalcin like-1 proteins. It may be involved in the calcium-dependent regulation of rhodopsin phosphorylation and may be of relevance for neuronal signalling in the central nervous system.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for VILIP3 antibody 10989-1-AP | Download protocol |
| IHC protocol for VILIP3 antibody 10989-1-AP | Download protocol |
| IP protocol for VILIP3 antibody 10989-1-AP | Download protocol |
| WB protocol for VILIP3 antibody 10989-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The VILIP3 Polyclonal antibody (Cat# 10989-1-AP) has 11 citations published in journals including Signal Transduction and Targeted Therapy, Autophagy, Nature Communications, Hepatology, Theranostics, Oncogenesis, Human Genomics, Molecular Carcinogenesis, Cancer Medicine, and Experimental Hematology & Oncology. Research fields span liver cancer, ferroptosis and autophagy, cortical malformation, hepatocellular carcinoma, liver lipid metabolism, colorectal cancer, liver fibrosis, breast cancer, cholangiocarcinoma, pancreatic cancer, and cell senescence.
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther Blockade of NMT1 enzymatic activity inhibits N-myristoylation of VILIP3 protein and suppresses liver cancer progression | ||
Autophagy Identification of HPCAL1 as a specific autophagy receptor involved in ferroptosis
| ||
Nat Commun Identification of genes associated with cortical malformation using a transposon-mediated somatic mutagenesis screen in mice. | ||
Hepatology Hippocalcin-like 1 suppresses hepatocellular carcinoma progression by promoting p21(Waf/Cip1) stabilization via activating ERK1/2-MAPK pathway.
| ||
Theranostics Hippocalcin-Like 1 blunts liver lipid metabolism to suppress tumorigenesis via directly targeting RUVBL1-mTOR signaling | ||
Oncogenesis HPCAL1 promotes colorectal cancer progression via TCF7/p65-mediated Wnt ligand upregulation and Wnt/β-catenin pathway activation. |
Reviews
What customers say
The product has received one review with a 5-star rating. The reviewer used it for Western Blot and reported that it works well, stating they would purchase it again. Overall, the feedback is positive, indicating satisfactory performance in WB applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Nicole (Verified Customer) (02-20-2026) | Works well, will purchase again
|
