HPGD Polyclonal antibody

• 

  WB analysis of human placenta using 11035-1-AP

  human placenta tissue were subjected to SDS PAGE followed by western blot with 11035-1-AP (HPGD antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IP experiment of human placenta using 11035-1-AP

  IP result of anti-HPGD (IP:11035-1-AP, 4ug; Detection:11035-1-AP 1:300) with human placenta tissue lysate 4000ug.

• 

  IHC staining of human colon cancer using 11035-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer using 11035-1-AP (HPGD antibody) at dilution of 1:50 (under 25x lens).

• 

  IF Staining of A549 using 11035-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed A549 cells using 11035-1-AP (HPGD antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

HPGD Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 11035-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

Eicosanoid/docosanoid dehydrogenase [NAD(+)], EC:1.1.1.141, EC:1.1.1.-, EC:1.1.1.232, 15-PGDH, 15-hydroxyprostaglandin dehydrogenase [NAD(+)]

---

Tested Applications

• Positive WB detected in: human placenta tissue
• Positive IP detected in: human placenta tissue
• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

11035-1-AP targets HPGD in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1499

  Product name: Recombinant human HPGD protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-266 aa of BC018986

  Sequence: MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNGAIMKITTSKGIHFQDYDTTPFQAKTQ

• Full Name: hydroxyprostaglandin dehydrogenase 15-(NAD)
• Calculated Molecular Weight: 29 kDa
• Observed Molecular Weight: 25-28 kDa
• GenBank Accession Number: BC018986
• Gene Symbol: HPGD
• Gene ID (NCBI): 3248
• RRID: AB_2120407
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P15428
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HPGD, also named as PGDH (15-hydroxyprostaglandin dehydrogenase), a prostaglandin-degrading enzyme that physiologically antagonizes COX-2 (PMID:15574495). HPGD inhibits in vivo proferation of colon cancer cells (PMID:24760190). HPGD has five isoforms with the molecular mass of 29, 21, 19, 16 and 15 kDa.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC,IF	Int J Mol Sci; The Enzyme 15-Hydroxyprostaglandin Dehydrogenase Inhibits a Shift to the Mesenchymal Pattern of Trophoblasts and Decidual Stromal Cells Accompanied by Prostaglandin Transporter in Preeclampsia; Authors - Huiyuan Pang