HPR Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• HPR Polyclonal antibody, PBS Only (33434-1-PBS)

• 

  WB analysis using 33434-1-AP (same clone as 33434-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 33434-1-AP (HPR antibody) at dilution of 1:40000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 33434-1-PBS in a different storage buffer formulation.

HPR Polyclonal Antibody for WB, Indirect ELISA

Cat No. 33434-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

Haptoglobin-related protein

---

Product Information

33434-1-PBS targets HPR in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg5219

  Product name: Recombinant human HPR protein

  Source: mammalian cells-derived, pHZ-KIsec-N-rFc

  Tag: N-rFc

  Domain: 20-348 aa of NM_020995.3

  Sequence: LYSGNDVTDISDDRFPKPPEIANGYVEHLFRYQCKNYYRLRTEGDGVYTLNDKKQWINKAVGDKLPECEAVCGKPKNPANPVQRILGGHLDAKGSFPWQAKMVSHHNLTTGATLINEQWLLTTAKNLFLNHSENATAKDIAPTLTLYVGKKQLVEIEKVVLHPNYHQVDIGLIKLKQKVLVNERVMPICLPSKNYAEVGRVGYVSGWGQSDNFKLTDHLKYVMLPVADQYDCITHYEGSTCPKWKAPKSPVGVQPILNEHTFCVGMSKYQEDTCYGDAGSAFAVHDLEEDTWYAAGILSFDKSCAVAEYGVYVKVTSIQHWVQKTIAEN

• Full Name: haptoglobin-related protein
• Calculated Molecular Weight: 39 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: NM_020995.3
• Gene Symbol: HPR
• Gene ID (NCBI): 3250
• RRID: AB_3742969
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P00739-1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Haptoglobin-related protein (Hpr) is a plasma protein with high sequence similarity to haptoglobin (Hp). Like Hp, Hpr also binds hemoglobin (Hb) with high affinity, but it does not bind to the Hb-Hp receptor CD163 on macrophages (PMID: 36129375).