HPRT Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86049-1-RR (same clone as 86049-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86049-1-RR (HPRT antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86049-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 86049-1-RR (same clone as 86049-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 86049-1-RR (HPRT antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86049-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 86049-1-RR (same clone as 86049-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 86049-1-RR (HPRT antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86049-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 86049-1-RR (same clone as 86049-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 86049-1-RR (HPRT antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86049-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 86049-1-RR (same clone as 86049-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 86049-1-RR (HPRT antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86049-1-PBS in a different storage buffer formulation.

HPRT Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 86049-1-PBS

Clone No.250656C2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

HPRT1, EC:2.4.2.8, HGPRT, HGPRTase, Hypoxanthine-guanine phosphoribosyltransferase

---

Product Information

86049-1-PBS targets HPRT in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag7044

  Product name: Recombinant human HPRT1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-218 aa of BC000578

  Sequence: MATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA

• Full Name: hypoxanthine phosphoribosyltransferase 1
• Calculated Molecular Weight: 25 kDa
• Observed Molecular Weight: 24-28 kDa
• GenBank Accession Number: BC000578
• Gene Symbol: HPRT1
• Gene ID (NCBI): 3251
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P00492
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

HPRT, also named HPRT1 and HGPRT, plays a central role in the generation of purine nucleotides through the purine salvage pathway. Mutation of HPRT is associated with Lesch-Nyhan syndrome (LNS) which is an X-linked inherited neurogenetic disorder of purine metabolism. It has been reported that HPRT1 also plays an important role in HPRT-related gout. Sp2/0 was reported in the literature as an HPRT1-deficient cell line. (PMID:20544509, 28045594, 27379977)