HRAS Polyclonal antibody

• Home
• Products
• Primary Antibodies
• HRAS Polyclonal antibody (15531-1-AP)

HRAS Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 15531-1-AP Copied!

Publications (3)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

Synonyms

GTPase HRas, H RASIDX, HRAS1, C BAS/HAS, C H RAS

• 

  WB analysis using 15531-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15531-1-AP (HRAS antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of PC-12 using 15531-1-AP

  PC-12 cells were subjected to SDS PAGE followed by western blot with 15531-1-AP (HRAS antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 15531-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 15531-1-AP (HRAS antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HeLa using 15531-1-AP

  IP result of anti-HRAS (IP:15531-1-AP, 4ug; Detection:15531-1-AP 1:300) with HeLa cells lysate 2600 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach using 15531-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 15531-1-AP (HRAS antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse intestine using 15531-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse intestine tissue slide using 15531-1-AP (HRAS antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for HRAS in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, MCF-7 cells, PC-12 cells, mouse kidney tissue, rat kidney tissue
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human stomach tissue, mouse intestine; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15531-1-AP targets HRAS in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7704

  Product name: Recombinant human HRAS protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-170 aa of BC006499

  Sequence: MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGSRSGSSSSSGTLWDPPGPM

• Full Name: v-Ha-ras Harvey rat sarcoma viral oncogene homolog
• Calculated Molecular Weight: 21 kDa
• Observed Molecular Weight: 21 kDa
• GenBank Accession Number: BC006499
• Gene Symbol: HRAS
• Gene ID (NCBI): 3265
• RRID: AB_2878147
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P01112
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HRAS belongs to the small GTPase superfamily and Ras family. RAS family proteins (KRAS4A, KRAS4B, NRAS and HRAS) function as GDP-GTP-regulated binary on-off switches, which regulate cytoplasmic signaling networks that control diverse normal cellular processes (PMID: 26985062). HRAS is Involved in the activation of Ras protein signal transduction (PMID: 22821884). As HRAS mutations are associated to activation of RAF/MEK/ERK signaling in different cancers (PMID: 25435214). HRAS is mostly altered in head and neck squamous cell carcinoma (HNSCC) (5-9%), salivary glands (15%), and bladder cancer (5-30%) (PMID: 35621690).

Publications

What published studies show

The HRAS polyclonal antibody (Cat# 15531-1-AP) has 3 total citations. These appear in Oncogene, Molecular Medicine Reports, and Naunyn-Schmiedeberg's Archives of Pharmacology. The associated research fields include RAS signaling pathway inhibition, multiple myeloma cell proliferation and apoptosis, and colorectal cancer mechanisms. All three studies used the antibody for Western blot in human samples.

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Oncogene; Inhibition and degradation of NRAS with a pan-NRAS monobody; Authors - Michael Whaby
human	WB	Mol Med Rep; Sirtuin 2 knockdown inhibits cell proliferation and RAS/ERK signaling, and promotes cell apoptosis and cell cycle arrest in multiple myeloma.; Authors - Tianling Ding
human	WB	Naunyn Schmiedebergs Arch Pharmacol; The potential mechanism of Neu5Gc inducing colorectal cancer based on network pharmacology and experimental validation; Authors - Li-Chao Zhang