HRH1 Polyclonal antibody

• 

  WB analysis of human colon using 13413-1-AP

  human colon tissue were subjected to SDS PAGE followed by western blot with 13413-1-AP (HRH1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 13413-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 13413-1-AP (HRH1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human endometrial cancer using 13413-1-AP

  Immunohistochemical analysis of paraffin-embedded human endometrial cancer using 13413-1-AP (HRH1 antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human endometrial cancer using 13413-1-AP

  Immunohistochemical analysis of paraffin-embedded human endometrial cancer using 13413-1-AP (HRH1 antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human trachea using 13413-1-AP

  Immunohistochemical analysis of paraffin-embedded human trachea using 13413-1-AP (HRH1 antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human colon cancer using 13413-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer using 13413-1-AP (HRH1 antibody) at dilution of 1:50 (under 25x lens).

• Featured Product
• KD/KO Validated

HRH1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 13413-1-AP

Publications(14)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

Synonyms

H1 R, H1R, HH1R, hisH1, Histamine H1 receptor, histamine receptor H1, HRH1

---

Tested Applications

• Positive WB detected in: human colon tissue, Jurkat cells
• Positive IHC detected in: human endometrial cancer tissue, human colon cancer tissue, human trachea tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 7 publications below
• IHC: See 7 publications below
• IF: See 5 publications below
• IP: See 1 publications below

Product Information

13413-1-AP targets HRH1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4067

  Product name: Recombinant human HRH1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 211-426 aa of BC060802

  Sequence: AKIYKAVRQHCQHRELINRSLPSFSEIKLRPENPKGDAKKPGKESPWEVLKRKPKDAGGGSVLKSPSQTPKEMKSPVVFSQEDDREVDKLYCFPLDIEHMQAAAEGSSRDYVAVNRSHGQLKTDEQGLNTHGASEISEDQMLGDSQSFSRTDSDTTTETAPGKGKLRSGSNTGLDYIKFTWKRLRSHSRQYVSGLHMNRERKAAKQLGFIMAAFIL

• Full Name: histamine receptor H1
• Calculated Molecular Weight: 487 aa, 56 kDa
• Observed Molecular Weight: 56 kDa
• GenBank Accession Number: BC060802
• Gene Symbol: HRH1
• Gene ID (NCBI): 3269
• RRID: AB_2092454
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P35367
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Stem Cell Reports; Epithelial-derived factors induce muscularis mucosa of human induced pluripotent stem cell-derived gastric organoids.; Authors - Keiichiro Uehara
human	WB	Aging (Albany NY); Combined impacts of histamine receptor H1 gene polymorphisms and an environmental carcinogen on the susceptibility to and progression of oral squamous cell carcinoma.; Authors - Yi-Fang Ding
mouse	WB	Front Cell Neurosci; Clemastine Alleviates Depressive-Like Behavior Through Reversing the Imbalance of Microglia-Related Pro-inflammatory State in Mouse Hippocampus.; Authors - Wen-Jun Su
human	WB,IHC,IF	J Virol; Kaposi's Sarcoma-Associated Herpesvirus Infection Induces the Expression of Neuroendocrine Genes in Endothelial Cells.; Authors - Mohanan Valiya Veettil ; KO Validated
rat	WB	Sci Rep; Gold nanoclusters eliminate obesity induced by antipsychotics.; Authors - Meng He
mouse	IHC	Am J Reprod Immunol; Decreased IL-33 Expression in the Cervix in LPS-Induced Preterm Birth and the Potential Role of Mast Cells: A Murine Model; Authors - Sema Avci