Tested Applications
| Positive WB detected in | mouse heart tissue, rat heart tissue |
| Positive IHC detected in | mouse liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
28763-1-AP targets HRH1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag30464 Product name: Recombinant human HRH1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 305-416 aa of BC060802 Sequence: LDIEHMQAAAEGSSRDYVAVNRSHGQLKTDEQGLNTHGASEISEDQMLGDSQSFSRTDSDTTTETAPGKGKLRSGSNTGLDYIKFTWKRLRSHSRQYVSGLHMNRERKAAKQ Predict reactive species |
| Full Name | histamine receptor H1 |
| Calculated Molecular Weight | 487 aa, 56 kDa |
| Observed Molecular Weight | 56 kDa |
| GenBank Accession Number | BC060802 |
| Gene Symbol | HRH1 |
| Gene ID (NCBI) | 3269 |
| RRID | AB_3086085 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P35367 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for HRH1 antibody 28763-1-AP | Download protocol |
| WB protocol for HRH1 antibody 28763-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The HRH1 Polyclonal antibody (Cat# 28763-1-AP) has 2 citations. One appears in Advanced Science (2026), addressing versatile cellular protein detection via fluorescence anisotropy. The other is in Transplantation (2026), investigating the role of histamine in liver ischemia-reperfusion injury and H1 receptor antagonist implications, using IHC in mouse tissue. The associated research fields span protein detection methodologies and hepatic injury/immunology.
| Species | Application | Title |
|---|---|---|
Transplantation Role of Histamine in Liver Ischemia-Reperfusion Injury-Implication for H1 Receptor Antagonist in the Clinical Application. |
Reviews
What customers say
The antibody performed well in Western Blot, detecting HRH1 in T-cells as a ~60 kDa band with minimal background at a 1:1000 dilution. The reviewer rated it 4 out of 5, indicating strong performance and specificity for the intended application.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Wojciech (Verified Customer) (09-23-2025) | HRH1 was detected in T-cells producing ~60 kDa band with minimal background when tested by western blot at 1:1000 dilution.
|
