HS3ST1 Polyclonal antibody

• 

  WB analysis of mouse spleen using 14358-1-AP

  mouse spleen tissue were subjected to SDS PAGE followed by western blot with 14358-1-AP (HS3ST1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse spleen using 14358-1-AP

  mouse spleen tissue were subjected to SDS PAGE followed by western blot with 14358-1-AP (HS3ST1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human heart using 14358-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart using 14358-1-AP (HS3ST1 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human heart using 14358-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart using 14358-1-AP (HS3ST1 antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human kidney using 14358-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 14358-1-AP (HS3ST1 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human kidney using 14358-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 14358-1-AP (HS3ST1 antibody) at dilution of 1:50 (under 40x lens).

HS3ST1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 14358-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF, IHC, ELISA

Synonyms

3 OST 1, 3OST, 3OST1, h3 OST 1, HS3ST1

---

Tested Applications

• Positive WB detected in: mouse spleen tissue
• Positive IHC detected in: human heart tissue, human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

14358-1-AP targets HS3ST1 in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5719

  Product name: Recombinant human HS3ST1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-307 aa of BC057803

  Sequence: MAALLLGAVLLVAQPQLVPSRTAELGQQELLRKAGTLQDDVRDGVAPNGSAQQLPQTIIIGVRKGGTRALLEMLSLHPDVAAAENEVHFFDWEEHYSHGLGWYLSQMPFSWPHQLTVEKTPAYFTSPKVPERVYSMNPSIRLLLILRDPSERVLSDYTQVFYNHMQKHKPYPSIEEFLVRDGRLNVDYKALNRSLYHVHMQNWLRFFPLRHIHIVDGDRLIRDPFPEIQKVERFLKLSPQINASNFYFNKTKGFYCLRDSGRDRCLHESKGRAHPQVDPKLLNKLHEYFHEPNKKFFELVGRTFDWH

• Full Name: heparan sulfate (glucosamine) 3-O-sulfotransferase 1
• Calculated Molecular Weight: 36 kDa
• GenBank Accession Number: BC057803
• Gene Symbol: HS3ST1
• Gene ID (NCBI): 9957
• RRID: AB_10805763
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O14792
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Front Oncol; Development and validation of a novel hypoxia-related signature for prognostic and immunogenic evaluation in head and neck squamous cell carcinoma; Authors - Su-Ran Li
human	IF	Sci Rep; Switching mechanism from AR to EGFR signaling via 3-O-sulfated heparan sulfate in castration-resistant prostate cancer; Authors - Hayato Ota