HSCB Polyclonal antibody

HSCB Polyclonal Antibody for ELISA
Cat No. 19846-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

ELISA

DNAJC20, HSC20, HSCB, JAC1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

19846-1-AP targets HSCB in ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag13897

Product name: Recombinant human HSCB protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-239 aa of BC000004

Sequence: AAGQMWRGRAGALLRVWGFWPTGVPRRRPLSCDAASQAGSNYPRCWNCGGPWGPGREDRFFCPQCRALQAPDPTRDYFSLMDCNRSFRVDTAKLQHRYQQLQRLVHPDFFSQRSQTEKDFSEKHSTLVNDAYKTLLAPLSRGLYLLKLHGIEIPERTDYEMDRQFLIEIMEINEKLAEAESEAAMKEIESIVKAKQKEFTDNVSSAFEQDDFEEAKEILTKMRYFSNIEEKIKLKKIPL

Predict reactive species
Full Name HscB iron-sulfur cluster co-chaperone homolog (E. coli)
Calculated Molecular Weight 235 aa, 27 kDa
GenBank Accession NumberBC000004
Gene Symbol HSCB
Gene ID (NCBI) 150274
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8IWL3
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.
Loading...
||
New chat Able
正在加载,请稍候...