HSD11B1 Polyclonal antibody

• 

  WB analysis of L02 using 10928-1-AP

  L02 cells were subjected to SDS PAGE followed by western blot with 10928-1-AP (HSD11B1 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  WB analysis of L02 using 10928-1-AP

  WB result of HSD11B1 antibody (10928-1-AP; 1:2400; incubated at room temperature for 1.5 hours) with sh-Control and sh-HSD11B1 transfected L02 cells.

• 

  WB analysis of mouse liver using 10928-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 10928-1-AP (HSD11B1 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 10928-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 10928-1-AP (HSD11B1 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HepG2 using 10928-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using HSD11B1 antibody (10928-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

HSD11B1 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 10928-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

7-oxosteroid reductase, 11-DH, 11-beta-hydroxysteroid dehydrogenase 1, 11-beta-HSD1, 11 DH

---

Tested Applications

• Positive WB detected in: L02 cells, mouse liver tissue, Jurkat cells
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 5 publications below
• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

10928-1-AP targets HSD11B1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1361

  Product name: Recombinant human HSD11B1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-292 aa of BC012593

  Sequence: MAFMKKYLLPILGLFMAYYYYSANEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKILEFLYSTSYNMDRFINK

• Full Name: hydroxysteroid (11-beta) dehydrogenase 1
• Calculated Molecular Weight: 36 kDa
• Observed Molecular Weight: 65-70 kDa
• GenBank Accession Number: BC012593
• Gene Symbol: HSD11B1
• Gene ID (NCBI): 3290
• RRID: AB_2119527
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P28845
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HSD11B1(Corticosteroid 11-beta-dehydrogenase isozyme 1) is also named as HSD11, HSD11L,11-DH and 11-beta-HSD1.It is a microsomal enzyme, which acts mainly as a NADP(H)- dependent reductase converting inactive cortisone (E) to active cortisol (F), thus regulating intracellular F access to glucocorticoid receptor. This enzyme is widely expressed not only in liver and adipose tissue, but also in adrenal, ovary and decidua.Western blot analysis in human liver, using a specific11-beta-HSD1 antibody, showed two bands at approximately 34 and 68 kDa confirming the dimeric nature of 11-beta-HSD1 in liver. In omental adipose tissue, an additional band of 50 kDa was strongly expressed(PMID:16914598).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Brain Behav Immun; HMGB1-mediated differential response on hippocampal neurotransmitter disorder and neuroinflammation in adolescent male and female mice following cold exposure.; Authors - Bin Xu
human	WB	J Assist Reprod Genet; Effect of luteinizing hormone concentration on transcriptome and subcellular organelle phenotype of ovarian granulosa cells.; Authors - Yu-Ting Wan
mouse	IF,WB,IHC	Int J Biol Sci; 11β-Hydroxysteroid Dehydrogenase Type 1 Facilitates Osteoporosis by Turning on Osteoclastogenesis through Hippo Signaling; Authors - Hanwen Li
human	WB	Gynecol Endocrinol; N6-methyladenosine demethylase FTO related to hyperandrogenism in PCOS via AKT pathway; Authors - Yuan-Xue Jing
mouse	WB	Geroscience; Adipose chemokine ligand CX3CL1 contributes to maintaining the hippocampal BDNF level, and the effect is attenuated in advanced age; Authors - Yoshinori Takei ; KD Validated