Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

HSD11B1 Polyclonal antibody

HSD11B1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IHC, IF/ICC, ELISA

11 beta HSD1, 11 DH, 11-beta-HSD1, 11-beta-hydroxysteroid dehydrogenase 1, 11-DH

Formulation:  PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for HSD11B1 in ?

Tested Applications

Positive WB detected inL02 cells, Jurkat cells
Positive IHC detected inhuman liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:200-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10928-1-AP targets HSD11B1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1361

Product name: Recombinant human HSD11B1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-292 aa of BC012593

Sequence: MAFMKKYLLPILGLFMAYYYYSANEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKILEFLYSTSYNMDRFINK

Predict reactive species
Full Name hydroxysteroid (11-beta) dehydrogenase 1
Calculated Molecular Weight 36 kDa
Observed Molecular Weight 65-70 kDa
GenBank Accession NumberBC012593
Gene Symbol HSD11B1
Gene ID (NCBI) 3290
RRIDAB_2119527
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP28845
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HSD11B1(Corticosteroid 11-beta-dehydrogenase isozyme 1) is also named as HSD11, HSD11L,11-DH and 11-beta-HSD1.It is a microsomal enzyme, which acts mainly as a NADP(H)- dependent reductase converting inactive cortisone (E) to active cortisol (F), thus regulating intracellular F access to glucocorticoid receptor. This enzyme is widely expressed not only in liver and adipose tissue, but also in adrenal, ovary and decidua.Western blot analysis in human liver, using a specific11-beta-HSD1 antibody, showed two bands at approximately 34 and 68 kDa confirming the dimeric nature of 11-beta-HSD1 in liver. In omental adipose tissue, an additional band of 50 kDa was strongly expressed(PMID:16914598).

Protocols

Product Specific Protocols
IF protocol for HSD11B1 antibody 10928-1-APDownload protocol
IHC protocol for HSD11B1 antibody 10928-1-APDownload protocol
WB protocol for HSD11B1 antibody 10928-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The HSD11B1 Polyclonal antibody (Cat# 10928-1-AP) has 16 total citations published in journals including Signal Transduction and Targeted Therapy, Advanced Science, International Journal of Biological Sciences, FASEB Journal, Brain, Behavior, and Immunity, and others. Research fields span endocrinology (glucocorticoid metabolism, HPA axis), reproductive biology (preeclampsia, PCOS, miscarriage), neuroscience (neuroinflammation, depression), oncology (CAR-NK cells, lung cancer), bone biology (osteoporosis), and toxicology.

SpeciesApplicationTitle
humanIF

Signal Transduct Target Ther

Cortisol-resistant CAR-NK cells overcome steroid-induced immunosuppression in lung cancer.

Authors - Soura Chakraborty
human, mouseWB

Adv Sci (Weinh)

Lithium Exposure Causes Trophoblast Cuproptosis by Upregulating FOXO1/STEAP4 Axis in Unexplained Miscarriage.

Authors - Shuaishuai Xing
mouseWB,IHC,IF

Int J Biol Sci

11β-Hydroxysteroid Dehydrogenase Type 1 Facilitates Osteoporosis by Turning on Osteoclastogenesis through Hippo Signaling

Authors - Hanwen Li
mouseWB

Brain Behav Immun

HMGB1-mediated differential response on hippocampal neurotransmitter disorder and neuroinflammation in adolescent male and female mice following cold exposure.

Authors - Bin Xu

Ecotoxicol Environ Saf

Multiomics elucidation of triclosan-induced gestational diabetes mellitus: Identification of key targets and molecular mechanisms.

Authors - Kaiyan Yang
mouseWB

Geroscience

Adipose chemokine ligand CX3CL1 contributes to maintaining the hippocampal BDNF level, and the effect is attenuated in advanced age

Authors - Yoshinori Takei
  • KD Validated
Loading...
||
New chat

Able™

正在加载,请稍候...