HSD11B2 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• HSD11B2 Recombinant monoclonal antibody (87244-1-RR)

• 

  WB analysis using 87244-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87244-1-RR (HSD11B2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 87244-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87244-1-RR (HSD11B2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  Affinity of 87244-1-RR

  Biolayer interferometry (BLl) kinetic assays of 87244-1-RR against Human HSD11B2 were performed. The affinity constant is below 1 pM.

HSD11B2 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87244-1-RR

Clone No.250591F12

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

11 beta HSD2, 11 DH2, 11-beta-HSD type II, 11-beta-HSD2, 11-beta-hydroxysteroid dehydrogenase type 2

---

Tested Applications

• Positive WB detected in: mouse kidney tissue, COLO 320 cells, HT-29 cells, Caco-2 cells, rat kidney tissue, human kidney tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87244-1-RR targets HSD11B2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag5146

  Product name: Recombinant human HSD11B2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-405 aa of BC036780

  Sequence: MERWPWPSGGAWLLVAARALLQLLRSDLRLGRPLLAALALLAALDWLCQRLLPPPAALAVLAAAGWIALSRLARPQRLPVATRAVLITGCDSGFGKETAKKLDSMGFTVLATVLELNSPGAIELRTCCSPRLRLLQMDLTKPGDISRVLEFTKAHTTSTGLWGLVNNAGHNEVVADAELSPVATFRSCMEVNFFGALELTKGLLPLLRSSRGRIVTVGSPAGDMPYPCLGAYGTSKAAVALLMDTFSCELLPWGVKVSIIQPGCFKTESVRNVGQWEKRKQLLLANLPQELLQAYGKDYIEHLHGQFLHSLRLAMSDLTPVVDAITDALLAARPRRRYYPGQGLGLMYFIHYYLPEGLRRRFLQAFFISHCLPRALQPGQPGTTPPQDAAQGPNLSPGPSPAVAR

• Full Name: hydroxysteroid (11-beta) dehydrogenase 2
• Calculated Molecular Weight: 405 aa, 44 kDa
• Observed Molecular Weight: 40-43 kDa
• GenBank Accession Number: BC036780
• Gene Symbol: HSD11B2
• Gene ID (NCBI): 3291
• RRID: AB_3745426
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P80365
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The HSD11B2 gene encodes the type II isoform of 11-beta-hydroxysteroid dehydrogenase, a microsomal enzyme complex responsible for the interconversion of biologically active cortisol and inactive cortisone. This protein catalyzes the cortisol-to-cortisone reaction. This protein expresses approximately 44 kDa in placenta, trophoblast, and distal colon, but in kidney tissue, there are two bands of approximately 44 and 48 kDa can be consistently observed and no signal is seen in decidua, adrenal, or liver(PMID:9048640).