HSD17B1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• HSD17B1 Polyclonal antibody (27830-1-AP)

HSD17B1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 27830-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

Human and More (1)

Applications

WB, IHC, ELISA

Synonyms

17 beta HSD 1, 20 alpha HSD, E17KSR, E2DH, EDH17B1, EDH17B2, EDHB17, HSD17, HSD17B1, SDR28C1

• 

  WB analysis of human placenta using 27830-1-AP

  human placenta tissue were subjected to SDS PAGE followed by western blot with 27830-1-AP (HSD17B1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human placenta using 27830-1-AP

  human placenta tissue were subjected to SDS PAGE followed by western blot with 27830-1-AP (HSD17B1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human placenta using 27830-1-AP

  human placenta tissue were subjected to SDS PAGE followed by western blot with 27830-1-AP (HSD17B1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 27830-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 27830-1-AP (HSD17B1 antibody) at dilution of 1:1000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 27830-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 27830-1-AP (HSD17B1 antibody) at dilution of 1:1000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 27830-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 27830-1-AP (HSD17B1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 27830-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 27830-1-AP (HSD17B1 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: human placenta tissue
• Positive IHC detected in: human placenta tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27830-1-AP targets HSD17B1 in WB, IHC, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27213

  Product name: Recombinant human HSD17B1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 191-328 aa of BC104752

  Sequence: TAFMEKVLGSPEEVLDRTDIHTFHRFYQYLAHSKQVFREAAQNPEEVAEVFLTALRAPKPTLRYFTTERFLPLLRMRLDDPSGSNYVTAMHREVFGDVPAKAEAGAEAGGGAGPGAEDEAGRSAVGDPELGDPPAAPQ

• Full Name: hydroxysteroid (17-beta) dehydrogenase 1
• Calculated Molecular Weight: 328 aa, 35 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC104752
• Gene Symbol: HSD17B1
• Gene ID (NCBI): 3292
• RRID: AB_2880985
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P14061
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Reprod Sci; KLOTHO Deficiency Drives Ovarian Aging by Inducing Granulosa Cell Senescence and Dysfunction.; Authors - Wenjing Du