HSD17B11 Polyclonal antibody

• 

  WB analysis of L02 using 16303-1-AP

  L02 cells were subjected to SDS PAGE followed by western blot with 16303-1-AP (HSD17B11 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse lung using 16303-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 16303-1-AP (HSD17B11 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 16303-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 16303-1-AP (HSD17B11 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse lung using 16303-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 16303-1-AP (HSD17B11 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 16303-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 16303-1-AP (HSD17B11 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse heart using 16303-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 16303-1-AP (HSD17B11 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human ovary using 16303-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tissue slide using 16303-1-AP (HSD17B11 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human ovary using 16303-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tissue slide using 16303-1-AP (HSD17B11 Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human ovary cancer using 16303-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovarian cancer slide using 16303-1-AP (HSD17B11 antibody) at dilution of 1:300 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

HSD17B11 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 16303-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

17-beta-HSD XI, 17-beta-HSD 11, 17 BETA HSDXI, 17 BETA HSD11, 17 beta HSD XI

---

Tested Applications

• Positive WB detected in: L02 cells, mouse heart tissue, mouse liver tissue, mouse lung tissue
• Positive IHC detected in: human ovary cancer tissue, human ovary tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:150-1:600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

16303-1-AP targets HSD17B11 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9278

  Product name: Recombinant human HSD17B11 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 33-300 aa of BC021673

  Sequence: SVTGEIVLITGAGHGIGRLTAYEFAKLKSKLVLWDINKHGLEETAAKCKGLGAKVHTFVVDCSNREDIYSSAKKVKAEIGDVSILVNNAGVVYTSDLFATQDPQIEKTFEVNVLAHFWTTKAFLPAMTKNNHGHIVTVASAAGHVSVPFLLAYCSSKFAAVGFHKTLTDELAALQITGVKTTCLCPNFVNTGFIKNPSTSLGPTLEPEEVVNRLMHGILTEQKMIFIPSSIAFLTTLERILPERFLAVLKRKISVKFDAVIGYKMKAQ

• Full Name: hydroxysteroid (17-beta) dehydrogenase 11
• Calculated Molecular Weight: 300 aa, 33 kDa
• Observed Molecular Weight: 28-33 kDa
• GenBank Accession Number: BC021673
• Gene Symbol: HSD17B11
• Gene ID (NCBI): 51170
• RRID: AB_2878241
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NBQ5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Biosci; m6A demethylase FTO promotes tumor progression via regulation of lipid metabolism in esophageal cancer.; Authors - Xiaoran Duan