HSD17B12 Polyclonal antibody

HSD17B12 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 27461-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

17 beta HSD 12, 17-beta-HSD 12, 17-beta-hydroxysteroid dehydrogenase 12, 3 ketoacyl CoA reductase, 3-ketoacyl-CoA reductase

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inCaco-2 cells, HCT 116 cells, HEK-293 cells, HT-29 cells, U-251 cells
Positive IHC detected inmouse ovary tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

27461-1-AP targets HSD17B12 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag26540

Product name: Recombinant human HSD17B12 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 203-271 aa of BC012043

Sequence: SATKTFVDFFSQCLHEEYRSKGVFVQSVLPYFVATKLAKIRKPTLDKPSPETFVKSAIKTVGLQSRTNG

Predict reactive species
Full Name hydroxysteroid (17-beta) dehydrogenase 12
Calculated Molecular Weight 312 aa, 34 kDa
Observed Molecular Weight30 kDa
GenBank Accession NumberBC012043
Gene Symbol HSD17B12
Gene ID (NCBI) 51144
RRIDAB_3669604
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ53GQ0
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Hydroxysteroid 17-beta dehydrogenase 12 (HSD17B12, also known as KAR and SDR12C1) is a key enzyme of steroid metabolism pathway19 and is the human homolog of the yeast 3-ketoacyl-CoA reductase that catalyzes the second reaction in each VLCFA elongation cycle (PMID: 16166196; 12482854). It also acts as a drug-metabolizing enzyme (PMID: 36724833). HSD17B12 deficiency in embryonic stem cells reduced the production of arachidonic acid, a precursor of prostaglandins (PMID: 20130115).

Protocols

Product Specific Protocols
IF protocol for HSD17B12 antibody 27461-1-APDownload protocol
IHC protocol for HSD17B12 antibody 27461-1-APDownload protocol
WB protocol for HSD17B12 antibody 27461-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...