HSD17B12 Polyclonal antibody

• 

  WB analysis using 27461-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27461-1-AP (HSD17B12 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse ovary using 27461-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 27461-1-AP (HSD17B12 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse ovary using 27461-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 27461-1-AP (HSD17B12 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 27461-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using HSD17B12 antibody (27461-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

HSD17B12 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 27461-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

17 beta HSD 12, 17-beta-HSD 12, 17-beta-hydroxysteroid dehydrogenase 12, 3 ketoacyl CoA reductase, 3-ketoacyl-CoA reductase

---

Tested Applications

• Positive WB detected in: Caco-2 cells, HCT 116 cells, HEK-293 cells, HT-29 cells, U-251 cells
• Positive IHC detected in: mouse ovary tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27461-1-AP targets HSD17B12 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26540

  Product name: Recombinant human HSD17B12 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 203-271 aa of BC012043

  Sequence: SATKTFVDFFSQCLHEEYRSKGVFVQSVLPYFVATKLAKIRKPTLDKPSPETFVKSAIKTVGLQSRTNG

• Full Name: hydroxysteroid (17-beta) dehydrogenase 12
• Calculated Molecular Weight: 312 aa, 34 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC012043
• Gene Symbol: HSD17B12
• Gene ID (NCBI): 51144
• RRID: AB_3669604
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q53GQ0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Hydroxysteroid 17-beta dehydrogenase 12 (HSD17B12, also known as KAR and SDR12C1) is a key enzyme of steroid metabolism pathway19 and is the human homolog of the yeast 3-ketoacyl-CoA reductase that catalyzes the second reaction in each VLCFA elongation cycle (PMID: 16166196; 12482854). It also acts as a drug-metabolizing enzyme (PMID: 36724833). HSD17B12 deficiency in embryonic stem cells reduced the production of arachidonic acid, a precursor of prostaglandins (PMID: 20130115).