HSD17B6 Polyclonal antibody

HSD17B6 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 11855-1-AP

Publications (5)

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

17 beta HSD 6, 17 beta HSD6, 3 alpha >beta HSE, HSD17B6, HSE, RODH, SDR9C6

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHC

WB analysis using 11855-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 11855-1-AP (HSD17B6 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of human liver using 11855-1-AP
human liver tissue were subjected to SDS PAGE followed by western blot with 11855-1-AP (HSD17B6 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human lung cancer using 11855-1-AP
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 11855-1-AP (HSD17B6 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human lung cancer using 11855-1-AP
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 11855-1-AP (HSD17B6 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human lung cancer using 11855-1-AP
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 11855-1-AP (HSD17B6 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human lung cancer using 11855-1-AP
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 11855-1-AP (HSD17B6 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human prostate hyperplasia using 11855-1-AP
Immunohistochemical analysis of paraffin-embedded human prostate hyperplasia tissue slide using 11855-1-AP (HSD17B6 Antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human prostate hyperplasia using 11855-1-AP
Immunohistochemical analysis of paraffin-embedded human prostate hyperplasia tissue slide using 11855-1-AP (HSD17B6 Antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver using 11855-1-AP
Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 11855-1-AP (HSD17B6 Antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver using 11855-1-AP
Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 11855-1-AP (HSD17B6 Antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for HSD17B6 in ?

Overview

Tested Applications
Product Information
Publications (5)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	mouse liver tissue, human liver tissue, rat liver tissue
Positive IHC detected in	human lung cancer tissue, human prostate hyperplasia tissue, human liver tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:500-1:1000
Immunohistochemistry (IHC)	IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11855-1-AP targets HSD17B6 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag2427 Product name: Recombinant human HSD17B6 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-317 aa of BC020710 Sequence: MWLYLAAFVGLYYLLHWYRERQVVSHLQDKYVFITGCDSGFGNLLARQLDARGLRVLAACLTEKGAEQLRGQTSDRLETVTLDVTKMESIAAATQWVKEHVGDRGLWGLVNNAGILTPITLCEWLNTEDSMNMLKVNLIGVIQVTLSMLPLVRRARGRIVNVSSILGRVAFFVGGYCVSKYGVEAFSDILRREIQHFGVKISIVEPGYFRTGMTNMTQSLERMKQSWKEAPKHIKETYGQQYFDALYNIMKEGLLNCSTNLNLVTDCMEHALTSVHPRTRYSAGWDAKFFFIPLSYLPTSLADYILTRSWPKPAQAV Predict reactive species
Full Name	hydroxysteroid (17-beta) dehydrogenase 6 homolog (mouse)
Calculated Molecular Weight	317 aa, 36 kDa
Observed Molecular Weight	33-35 kDa
GenBank Accession Number	BC020710
Gene Symbol	HSD17B6
Gene ID (NCBI)	8630
RRID	AB_2295487
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	O14756
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IHC protocol for HSD17B6 antibody 11855-1-AP	Download protocol
WB protocol for HSD17B6 antibody 11855-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The anti-HSD17B6 antibody (Cat# 11855-1-AP) has 5 published citations across Cell Death Discovery, Cancer Cell International, Probiotics Antimicrob Proteins, Breast Cancer Research and Treatment, and Toxicology Letters. Research fields span oncology (lung adenocarcinoma, hepatocellular carcinoma, triple-negative breast cancer), inflammatory bowel disease, and hepatic steatosis/toxicology, with applications in Western blot and IHC.

Species	Application	Title
human	WB	Cell Death Discov HSD17B6 downregulation predicts poor prognosis and drives tumor progression via activating Akt signaling pathway in lung adenocarcinoma Authors - Tian Tian View Article
human	WB	Cancer Cell Int Downexpression of HSD17B6 correlates with clinical prognosis and tumor immune infiltrates in hepatocellular carcinoma. Authors - Lei Lv View Article
		Probiotics Antimicrob Proteins Enterococcus hirae Y-HS Alleviates Ulcerative Colitis by Activating PXR/Nrf2-mediated Metabolic-immune Crosstalk. Authors - Fuming You View Article
human	IHC	Breast Cancer Res Treat The presence and impact of estrogen metabolism on the biology of triple-negative breast cancer. Authors - Keely May McNamara View Article
mouse	WB	Toxicol Lett Metabolomics reveals dysregulated all-trans retinoic acid and polyunsaturated fatty acid metabolism contribute to PXR-induced hepatic steatosis in mice Authors - Liang Yan View Article