HSD17B8 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• HSD17B8 Polyclonal antibody (16752-1-AP)

HSD17B8 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 16752-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

17 beta HSD 8, D6S2245E, FABG, FABGL, H2 KE6, HKE6, HSD17B8, Ke 6, KE6, Protein Ke6, RING2, SDR30C1

• 

  WB analysis using 16752-1-AP

  Hela cells lysates were subjected to SDS PAGE followed by western blot with 16752-1-AP (HSD17B8 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human testis using 16752-1-AP

  human testis tissue were subjected to SDS PAGE followed by western blot with 16752-1-AP (HSD17B8 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 16752-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 16752-1-AP (HSD17B8 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 16752-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 16752-1-AP (HSD17B8 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 16752-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 16752-1-AP (HSD17B8 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 16752-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 16752-1-AP (HSD17B8 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse kidney using 16752-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 16752-1-AP (HSD17B8 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse kidney using 16752-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 16752-1-AP (HSD17B8 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HeLa cells, mouse liver tissue, mouse small intestine tissue, human testis tissue
• Positive IHC detected in: human liver cancer tissue, mouse kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16752-1-AP targets HSD17B8 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10226

  Product name: Recombinant human HSD17B8 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-261 aa of BC008185

  Sequence: MASQLQNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDLDRAAAQETVRLLGGPGSKEGPPRGNHAAFQADVSEARAARCLLEQVQACFSRPPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGCRGSIINISSIVGKVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSGYITGTSVEVTGGLFM

• Full Name: hydroxysteroid (17-beta) dehydrogenase 8
• Calculated Molecular Weight: 261 aa, 27 kDa
• Observed Molecular Weight: 34 kDa
• GenBank Accession Number: BC008185
• Gene Symbol: HSD17B8
• Gene ID (NCBI): 7923
• RRID: AB_2248540
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q92506
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Cell Rep; High glucose impairs cognitive function by inducing lipid droplet accumulation through lactylation of HSD17B10 at K105.; Authors - Jingxi Xu
human	WB	Nat Commun; Cell facilitation promotes growth and survival under drug pressure in breast cancer; Authors - Rena Emond