HSDL2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• HSDL2 Polyclonal antibody (15631-1-AP)

• Featured Product
• KD/KO Validated

HSDL2 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 15631-1-AP Copied!

Publications (10)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

C9orf99, EC:1.-.-.-, Hydroxysteroid dehydrogenase-like protein 2, SDR13C1, Short chain dehydrogenase/reductase family 13C member 1

• 

  WB analysis of HepG2 using 15631-1-AP

  WB result of HSDL2 antibody (15631-1-AP; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-HSDL2 transfected HepG2 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 15631-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15631-1-AP (HSDL2 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 15631-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 15631-1-AP (HSDL2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 15631-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 15631-1-AP (HSDL2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 15631-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 15631-1-AP (HSDL2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 15631-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 15631-1-AP (HSDL2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 15631-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using HSDL2 antibody (15631-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for HSDL2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A549 cells, HepG2 cells, HeLa cells, MCF-7 cells, U-251 cells
• Positive IHC detected in: human liver cancer tissue, human prostate cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15631-1-AP targets HSDL2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7987

  Product name: Recombinant human HSDL2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-345 aa of BC004331

  Sequence: MLPNTGRLAGCTVFITGASRGIGKAIALKAAKDGANIVIAAKTAQPHPKLLGTIYTAAEEIEAVGGKALPCIVDVRDEQQISAAVEKAIKKFGAYTIAKYGMSMYVLGMAEEFKGEIAVNALWPKTAIHTAAMDMLGGPGIESQCRKVDIIADAAYSIFQKPKSFTGNFVIDENILKEEGIENFDVYAIKPGHPLQPDFFLDEYPEAVSKKVESTGAVPEFKEEKLQLQPKPRSGAVEETFRIVKDSLSDDVVKATQAIYLFELSGEDGGTWFLDLKSKGGNVGYGEPSDQADVVMSMTTDDFVKMFSGKLKPTMAFMSGKLKIKGNMALAIKLEKLMNQMNARL

• Full Name: hydroxysteroid dehydrogenase like 2
• Calculated Molecular Weight: 45 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC004331
• Gene Symbol: HSDL2
• Gene ID (NCBI): 84263
• RRID: AB_2120238
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6YN16
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Human hydroxysteroid dehydrogenase-like 2 (HSDL2) is a characterized SDR gene that not only catalyses the oxidation and reduction of multiple substrates but also regulates different metabolic and signalling pathways. Accumulating evidences suggest that HSDL2 play an important role in cancer progression. HSDL2 has promoting effects on tumor progression in papillary thyroid cancer, bladder cancer, ovarian cancer, and glioma, but has suppressing effects in cholangiocarcinoma . ( PMID: 31372054, PMID: 32211805)

Publications

What published studies show

The anti-HSDL2 antibody (Cat# 15631-1-AP) has 10 citations published in journals including Science Advances, Neurotherapeutics, BMC Cancer, Proteomics, Chinese Medicine, Drug Design, Development and Therapy, Cell Biology and Toxicology, Cancer Management and Research, OncoTargets and Therapy, and Nan Fang Yi Ke Da Xue Xue Bao. Research fields span lipid metabolism, bile acid/cholesterol homeostasis, epilepsy, cardiomyocyte protection, diabetic cognitive dysfunction, virology, and multiple cancers including melanoma, cervical, breast, pancreatic, and rectal cancer.

Automatically generated from the 10 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,human	WB,IF	Sci Adv; HSDL2 links nutritional cues to bile acid and cholesterol homeostasis; Authors - Nolwenn Samson
human	WB	Neurotherapeutics; Mitochondria-related HSDL2 is a potential biomarker in temporal lobe epilepsy by modulating astrocytic lipid metabolism; Authors - Xiaxin Yang ; KD Validated
human	WB	Chin Med; Cucurbitacin E inhibits cellular proliferation and induces apoptosis in melanoma by suppressing HSDL2 expression.; Authors - Wen-Bei Liu ; KD Validated
mouse	WB	Drug Des Devel Ther; Semaglutide Reduces Cardiomyocyte Damage Caused by High-Fat Through HSDL2; Authors - Lin Yang ; KD Validated
		Cell Biol Toxicol; SIRT5-mediated HSDL2 desuccinylation promotes diabetic-associated cognitive dysfunction via disrupting mitochondrial TRAP1.; Authors - Yinmeng Qu
human	WB	Proteomics; Proteome analysis of porcine epidemic diarrhea virus (PEDV)-infected vero cells.; Authors - Songlin Zeng