HSF1 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• HSF1 Recombinant monoclonal antibody (88318-1-RR)

HSF1 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 88318-1-RR

Clone No.260631H4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

HSF 1, HSTF 1, HSTF1

• 

  WB analysis using 88318-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 88318-1-RR (HSF1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of Human lung cancer （Adenocarcinoma） using 88318-1-RR

  Immunohistochemical analysis of paraffin-embedded Human lung cancer (Adenocarcinoma) slide using 88318-1-RR (HSF1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 88318-1-RR

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using HSF1 antibody (88318-1-RR, Clone: 260631H4 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: A431 cells, HEK-293 cells, HeLa cells, K-562 cells, HepG2 cells
• Positive IHC detected in: Human lung cancer （Adenocarcinoma）; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

88318-1-RR targets HSF1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0739

  Product name: Recombinant human HSF1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 230-529 aa of BC014638

  Sequence: SLEHVHGSGPYSAPSPAYSSSSLYAPDAVASSGPIISDITELAPASPMASPGGSIDERPLSSSPLVRVKEEPPSPPQSPRVEEASPGRPSSVDTLLSPTALIDSILRESEPAPASVTALTDARGHTDTEGRPPSPPPTSTPEKCLSVACLDKNELSDHLDAMDSNLDNLQTMLSSHGFSVDTSALLDLFSPSVTVPDMSLPDLDSSLASIQELLSPQEPPRPPEAENSSPDSGKQLVHYTAQPLFLLDPGSVDTGSNDLPVLFELGEGSYFSEGDGFAEDPTISLLTGSEPPKAKDPTVS

• Full Name: heat shock transcription factor 1
• Calculated Molecular Weight: 529 aa, 57 kDa
• Observed Molecular Weight: 68-80 kDa
• GenBank Accession Number: BC014638
• Gene Symbol: HSF1
• Gene ID (NCBI): 3297
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q00613
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HSF1 belongs to heat-shock transcription factors that activate heat-shock response genes under conditions of heat or other stresses. Also, HSF1 has been linked with oogenesis, spermatogenesis, and placental development. It can activate AKT and inactivate JNK and CASP3 to protect cardiomyocytes from death. And it has a role in the regulation of life span and establishes a role for SIRT1 in protein homeostasis and heat-shock response. The calculated molecular weight of HSF1 is 57 kDa, but HSF1 migrates at approximately 80 kDa which likely represents different phosphorylation states (PMID: 18434628).