HSF2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• HSF2 Polyclonal antibody (10706-1-AP)

• Featured Product
• KD/KO Validated

HSF2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 10706-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, Mouse, rat

Applications

WB, IHC, ELISA

Synonyms

Heat shock factor protein 2, HSF 2, HSF2, HSTF 2, HSTF2

• 

  WB analysis using 10706-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10706-1-AP (HSF2 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Jurkat using 10706-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 10706-1-AP (HSF2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse testis using 10706-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 10706-1-AP (HSF2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse testis using 10706-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 10706-1-AP (HSF2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat testis using 10706-1-AP

  Immunohistochemical analysis of paraffin-embedded rat testis tissue slide using 10706-1-AP (HSF2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat testis using 10706-1-AP

  Immunohistochemical analysis of paraffin-embedded rat testis tissue slide using 10706-1-AP (HSF2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for HSF2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HepG2 cells, Jurkat cells, A549 cells
• Positive IHC detected in: mouse testis tissue, rat testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10706-1-AP targets HSF2 in WB, IHC, ELISA applications and shows reactivity with human, Mouse, rat samples.

• Tested Reactivity: human, Mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1067

  Product name: Recombinant human HSF2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-230 aa of BC005329

  Sequence: MKQSSNVPAFLSKLWTLVEETHTNEFITWSQNGQSFLVLDEQRFAKEILPKYFKHNNMASFVRQLNMYGFRKVVHIDSGIVKQERDGPVEFQHPYFKQGQDDLLENIKRKVSSSKPEENKIRQEDLTKIISSAQKVQIKQETIESRLSELKSENESLWKEVSELRAKHAQQQQVIRKIVQFIVTLVQNNQLVSLKRKRPLLLNTNGAQKKNLFQHIVKEPTDNHHHKVIF

• Full Name: heat shock transcription factor 2
• Calculated Molecular Weight: 79 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC005329
• Gene Symbol: HSF2
• Gene ID (NCBI): 3298
• RRID: AB_2120443
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q03933
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The HSF2 Polyclonal antibody (Cat# 10706-1-AP) has 2 citations. These appear in Free Radical Biology and Medicine and American Journal of Cancer Research. The associated research fields include cuproptosis and chromatin remodeling, as well as aerobic glycolysis regulation in hepatocellular carcinoma.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Free Radic Biol Med; CHD4 is a copper sensor linking chromatin remodeling to cuproptosis.; Authors - Yongjie Wang
human	WB	Am J Cancer Res; HSF2 regulates aerobic glycolysis by suppression of FBP1 in hepatocellular carcinoma.; Authors - Li-Na Yang ; KD Validated