HSF2BP Polyclonal antibody

• Home
• Products
• Primary Antibodies
• HSF2BP Polyclonal antibody (32594-1-AP)

• 

  WB analysis using 32594-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32594-1-AP (HSF2BP antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of A431 using 32594-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using HSF2BP antibody (32594-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

HSF2BP Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 32594-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

MEILB2, Heat shock factor 2-binding protein

---

Tested Applications

• Positive WB detected in: human testis tissue, mouse testis tissue, rat testis tissue
• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32594-1-AP targets HSF2BP in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37637

  Product name: Recombinant human HSF2BP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-334 aa of BC000153

  Sequence: MGEAGAAEEACRHMGTKEEFVKVRKKDLERLTTEVMQIRDFLPRILNGEVLESFQKLKIVEKNLERKEQELEQLKMDCEHFKARLETVQADNIREKKEKLALRQQLNEAKQQLLQQAEYCTEMGAAACTLLWGVSSSEEVVKAILGGDKALKFFSITGQTMESFVKSLDGDVQELDSDESQFVFALAGIVTNVAAIACGREFLVNSSRVLLDTILQLLGDLKPGQCTKLKVLMLMSLYNVSINLKGLKYISESPGFIPLLWWLLSDPDAEVCLHVLRLVQSVVLEPEVFSKSASEFRSSLPLQRILAMSKSRNPRLQTAAQELLEDLRTLEHNV

• Full Name: heat shock transcription factor 2 binding protein
• Calculated Molecular Weight: 38 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC000153
• Gene Symbol: HSF2BP
• Gene ID (NCBI): 11077
• RRID: AB_3742668
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: O75031
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Heat shock factor 2-binding protein (HSF2BP, also known as MEILB2) is a binding protein of HSF2, which is involved in modulating HSF2 activation in testis (PMID: 9651507). Naturally occurring elevated production of HSF2BP in tumors may be a source of cancer-promoting genomic instability and a vulnerable target (PMID: 31960047; 34790765).