HSF5 Polyclonal antibody

• 

  WB analysis of Jurkat using 17765-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 17765-1-AP (HSF5 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 17765-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 17765-1-AP (HSF5 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  IF Staining of mouse testis using 17765-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse testis tissue using HSF5 antibody (17765-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

HSF5 Polyclonal Antibody for WB, IF-P, ELISA

Cat No. 17765-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF-P, ELISA

Synonyms

HSTF5, HSTF 5, HSF 5

---

Tested Applications

• Positive WB detected in: Jurkat cells
• Positive IF-P detected in: mouse testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

17765-1-AP targets HSF5 in WB, IF-P, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12168

  Product name: Recombinant human HSF5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-350 aa of BC033017

  Sequence: MEALLSTPINPNNFPAKLWRLVNSPRYRSIRWDGRGEGLLIDQPLFEAELLSPPGPGGGGGTAGAGAEPELFKTTSFTSFIRQLNLYGFRKVVLGGPGGGKPAGNGPLHHFHNPHFRRDQPQLLVHLKRLTSANKAKLAAGLEVPCRPPNRFQRLLITSASAATAPLQHQQPPPPAGPRPEPHGPVAVGQFHRSFRRDSLSPYSCVSTPSHDHSTYPLKGLDRTPVPHRIWQNSLGMHPGQVETSPTFSDKGVPFPVLQRFPTEVTYTLQPSTTSVHVQQGPQTMVSSSQKYSNYTPSAQYSQAYYPTAVLQCCSPTHMDALSSCVTPTASSYAHCNYFQNPSMQSSYPV

• Full Name: heat shock transcription factor family member 5
• Calculated Molecular Weight: 596 aa, 65 kDa
• Observed Molecular Weight: 65 kDa
• GenBank Accession Number: BC033017
• Gene Symbol: HSF5
• Gene ID (NCBI): 124535
• RRID: AB_2233301
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q4G112
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Heat shock transcription factor 5 (HSF5) is a member of the HSF family, which are well-known transcriptional regulators of genes encoding heat shock proteins and other types of proteins and have functions in reproduction, the immune response, and the aging process. HSF5 is a non-canonical HSF that possesses a winged- helix-turn-helix (WHTH)-like DNA-binding domain and is specifically expressed in the testis (PMID: 38958533, PMID: 39162221).