Home
Products
Primary Antibodies
HSP10 Polyclonal antibody, PBS Only (16512-1-PBS)

Filter: AllWBIHC

WB analysis using 16512-1-AP (same clone as 16512-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 16512-1-AP (HSP10 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16512-1-PBS in a different storage buffer formulation.
IHC staining of human lung cancer using 16512-1-AP (same clone as 16512-1-PBS)
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 16512-1-AP (HSP10 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16512-1-PBS in a different storage buffer formulation.
IHC staining of human lung cancer using 16512-1-AP (same clone as 16512-1-PBS)
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 16512-1-AP (HSP10 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16512-1-PBS in a different storage buffer formulation.
IHC staining of mouse adrenal gland using 16512-1-AP (same clone as 16512-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse adrenal gland tissue slide using 16512-1-AP (HSP10 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16512-1-PBS in a different storage buffer formulation.
IHC staining of mouse adrenal gland using 16512-1-AP (same clone as 16512-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse adrenal gland tissue slide using 16512-1-AP (HSP10 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16512-1-PBS in a different storage buffer formulation.

HSP10 Polyclonal antibody, PBS Only

Name: HSP10 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 16512-1-PBS

HSP10 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 16512-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

HSPE1, 10 kDa chaperonin, CPN10, Early-pregnancy factor, Heat shock protein family E member 1

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

16512-1-PBS targets HSP10 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag9732 Product name: Recombinant human HSPE1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-102 aa of BC023518 Sequence: MAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD Predict reactive species
Full Name	heat shock 10kDa protein 1 (chaperonin 10)
Calculated Molecular Weight	102 aa, 11 kDa
Observed Molecular Weight	11 kDa
GenBank Accession Number	BC023518
Gene Symbol	HSP10
Gene ID (NCBI)	3336
RRID	AB_3085493
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P61604
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.