HSPA12A Polyclonal antibody

• Home
• Products
• Primary Antibodies
• HSPA12A Polyclonal antibody (33696-1-AP)

• 

  WB analysis using 33696-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33696-1-AP (HSPA12A antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

HSPA12A Polyclonal Antibody for WB, ELISA

Cat No. 33696-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

Heat shock 70 kDa protein 12A, Heat shock protein family A member 12A, KIAA0417

---

Tested Applications

• Positive WB detected in: fetal human brain tissue, mouse brain tissue, rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33696-1-AP targets HSPA12A in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36620

  Product name: Recombinant human HSPA12A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 516-675 aa of BC156889

  Sequence: PPEKLLVKDGTRWCTDVFDKFISADQSVALGELVKRSYTPAKPSQLVIVINIYSSEHDNVSFITDPGVKKCGTLRLDLTGTSGTAVPARREIQTLMQFGDTEIKATAIDIATSKSVKVGIDFLNY

• Full Name: heat shock 70kDa protein 12A
• Calculated Molecular Weight: 675 aa, 75 kDa
• Observed Molecular Weight: 75 kDa
• GenBank Accession Number: BC156889
• Gene Symbol: HSPA12A
• Gene ID (NCBI): 259217
• RRID: AB_3743052
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: O43301
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Heat shock protein A12A (HSPA12A) is a distant member of the HSP70 family, which is widely expressed with highest levels in brain, kidney and muscle (PMID: 12552099). HSPA12A encodes a prosurvival pathway against endotoxemic liver injury. Particularly, glycolytic activity in cancer cells is regulated by HSPA12A. HSPA12A modulates glycolysis-derived lactate to affect HMGB1 lactylation and secretion from hepatocytes, by which changes macrophage chemotaxis and activation, and finally affects LI/R injury (PMID: 37441587).