HSPA13 Polyclonal antibody

• 

  WB analysis using 12667-2-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12667-2-AP (HSPA13 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 12667-2-AP

  IP result of anti-HSPA13 (IP:12667-2-AP, 4ug; Detection:12667-2-AP 1:300) with HeLa cells lysate 1200ug.

• 

  IHC staining of mouse pancreas using 12667-2-AP

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 12667-2-AP (HSPA13 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse pancreas using 12667-2-AP

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 12667-2-AP (HSPA13 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

HSPA13 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 12667-2-AP

Publications(8)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF, IP, CoIP, ELISA

Synonyms

Heat shock 70 kDa protein 13, Heat shock protein family A member 13, Microsomal stress-70 protein ATPase core, STCH, Stress-70 protein chaperone microsome-associated 60 kDa protein

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cells, K-562 cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: mouse pancreas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:12000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 3 publications below
• WB: See 8 publications below
• IHC: See 2 publications below
• IF: See 1 publications below
• CoIP: See 1 publications below

Product Information

12667-2-AP targets HSPA13 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3349

  Product name: Recombinant human HSPA13 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 165-471 aa of BC036370

  Sequence: MPVANAVISVPAEFDLKQRNSTIEAANLAGLKILRVINEPTAAAMAYGLHKADVFHVLVIDLGGGTLDVSLLNKQGGMFLTRAMSGNNKLGGQDFNQRLLQYLYKQIYQTYGFVPSRKEEIHRLRQAVEMVKLNLTLHQSAQLSVLLTVEEQDRKEPHSSDTELPKDKLSSADDHRVNSGFGRGLSDKKSGESQVLFETEISRKLFDTLNEDLFQKILVPIQQVLKEGHLEKTEIDEVVLVGGSTRIPRIRQVIQEFFGKDPNTSVDPDLAVVTGVAIQAGIDGGFWPLQVSALEIPNKHLQKTNFN

• Full Name: heat shock protein 70kDa family, member 13
• Calculated Molecular Weight: 471 aa, 52 kDa
• Observed Molecular Weight: 52 kDa
• GenBank Accession Number: BC036370
• Gene Symbol: HSPA13
• Gene ID (NCBI): 6782
• RRID: AB_2119204
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P48723
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HSPA13 (Heat shock 70 kDa protein 13), also known as STCH (the stress 70 protein chaperone), is a member of the Hsp70 family of ATPase "stress" or "heat shock" proteins. Human STCH encodes a 60 kDa protein that is highly enriched in the ER. Recently it has been reported that overexpression of the HSPA13 gene reduces prion disease incubation time in mice.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Sci Adv; HSPA13 facilitates NF-κB-mediated transcription and attenuates cell death responses in TNFα signaling.; Authors - Chun Gao ; KO Validated
human	WB	Proc Natl Acad Sci U S A; Overexpression of the Hspa13 (Stch) gene reduces prion disease incubation time in mice.; Authors - Grizenkova Julia J
human	WB	Endocrinology; Reassessment of the Proteomic Composition and Function of Extracellular Vesicles in the Seminal Plasma.; Authors - Hanshu Wang
human	WB,IHC	Proteome Sci; PRM-based quantitative proteomics analysis of altered HSP abundance in villi and decidua of patients with early missed abortion; Authors - Xiao-Fang Chen
human	WB,IHC,CoIP	Cell Death Discov; Heat shock protein HSPA13 promotes hepatocellular carcinoma progression by stabilizing TANK; Authors - Xuesong Cen ; KD Validated
human	WB	Endocrinology; Human seminal extracellular vesicles enhance endometrial receptivity through leukemia inhibitory factor; Authors - Hanshu Wang