HSPA13 Recombinant monoclonal antibody, PBS Only (Capture/Detector)

HSPA13 Uni-rAb® Recombinant Antibody for Cytometric bead array, Indirect ELISA
Cat No. 84426-1-PBS
Clone No.241572B3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

Heat shock 70 kDa protein 13, Heat shock protein family A member 13, Microsomal stress-70 protein ATPase core, STCH, Stress-70 protein chaperone microsome-associated 60 kDa protein

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84426-1-PBS targets HSPA13 as part of a matched antibody pair:

MP01302-1: 84426-1-PBS capture and 84426-2-PBS detection (validated in Cytometric bead array)

MP01302-3: 84426-3-PBS capture and 84426-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag3349

Product name: Recombinant human HSPA13 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 165-471 aa of BC036370

Sequence: MPVANAVISVPAEFDLKQRNSTIEAANLAGLKILRVINEPTAAAMAYGLHKADVFHVLVIDLGGGTLDVSLLNKQGGMFLTRAMSGNNKLGGQDFNQRLLQYLYKQIYQTYGFVPSRKEEIHRLRQAVEMVKLNLTLHQSAQLSVLLTVEEQDRKEPHSSDTELPKDKLSSADDHRVNSGFGRGLSDKKSGESQVLFETEISRKLFDTLNEDLFQKILVPIQQVLKEGHLEKTEIDEVVLVGGSTRIPRIRQVIQEFFGKDPNTSVDPDLAVVTGVAIQAGIDGGFWPLQVSALEIPNKHLQKTNFN

Predict reactive species
Full Name heat shock protein 70kDa family, member 13
Calculated Molecular Weight 471 aa, 52 kDa
GenBank Accession NumberBC036370
Gene Symbol HSPA13
Gene ID (NCBI) 6782
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP48723
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...