HSPA13 Recombinant monoclonal antibody, PBS Only (Capture)

• 

  Cytometric bead array sample test of MP01302-2

  The mean HSPA13 concentration was determined to be 20.5 ng/mL in HEK-293 cell extract based on a 1.2 mg/mL extract load, 18.5 ng/mL in HeLa cell extract based on a 1.2 mg/mL extract load, 12.8 ng/mL in K-562 cell extract based on a 1.2 mg/mL extract load.

• 

  Cytometric bead array standard curve of MP01302-2

  Cytometric bead array standard curve of MP01302-2, HSPA13 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 84426-4-PBS. Detection antibody: 84426-2-PBS. Standard: Ag3349. Range: 0.781-100 ng/mL.

HSPA13 Uni-rAb^® Recombinant Antibody for Cytometric bead array, Indirect ELISA

Cat No. 84426-4-PBS

Clone No.241572F5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

Synonyms

Heat shock 70 kDa protein 13, Heat shock protein family A member 13, Microsomal stress-70 protein ATPase core, STCH, Stress-70 protein chaperone microsome-associated 60 kDa protein

---

Product Information

84426-4-PBS targets HSPA13 as part of a matched antibody pair:

MP01302-2: 84426-4-PBS capture and 84426-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag3349

  Product name: Recombinant human HSPA13 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 165-471 aa of BC036370

  Sequence: MPVANAVISVPAEFDLKQRNSTIEAANLAGLKILRVINEPTAAAMAYGLHKADVFHVLVIDLGGGTLDVSLLNKQGGMFLTRAMSGNNKLGGQDFNQRLLQYLYKQIYQTYGFVPSRKEEIHRLRQAVEMVKLNLTLHQSAQLSVLLTVEEQDRKEPHSSDTELPKDKLSSADDHRVNSGFGRGLSDKKSGESQVLFETEISRKLFDTLNEDLFQKILVPIQQVLKEGHLEKTEIDEVVLVGGSTRIPRIRQVIQEFFGKDPNTSVDPDLAVVTGVAIQAGIDGGFWPLQVSALEIPNKHLQKTNFN

• Full Name: heat shock protein 70kDa family, member 13
• Calculated Molecular Weight: 471 aa, 52 kDa
• GenBank Accession Number: BC036370
• Gene Symbol: HSPA13
• Gene ID (NCBI): 6782
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P48723
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.