HSPA13 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of HEK-293 using 84426-5-RR (same clone as 84426-5-PBS)

  WB result of HSPA13 antibody (84426-5-RR; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-HSPA13 transfected HEK-293 cells. This data was developed using the same antibody clone with 84426-5-PBS in a different storage buffer formulation.

• 

  WB analysis using 84426-5-RR (same clone as 84426-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84426-5-RR (HSPA13 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84426-5-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84426-5-RR

  Biolayer interferometry (BLl) kinetic assays of 84426-5-RR against Human HSPA13 were performed. The affinity constant is 39.3 nM.

• Featured Product
• KD/KO Validated

HSPA13 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 84426-5-PBS

Clone No.241572E4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

241572E4, Heat shock 70 kDa protein 13, Heat shock protein family A member 13, Microsomal stress-70 protein ATPase core, STCH

---

Product Information

84426-5-PBS targets HSPA13 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag3349

  Product name: Recombinant human HSPA13 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 165-471 aa of BC036370

  Sequence: MPVANAVISVPAEFDLKQRNSTIEAANLAGLKILRVINEPTAAAMAYGLHKADVFHVLVIDLGGGTLDVSLLNKQGGMFLTRAMSGNNKLGGQDFNQRLLQYLYKQIYQTYGFVPSRKEEIHRLRQAVEMVKLNLTLHQSAQLSVLLTVEEQDRKEPHSSDTELPKDKLSSADDHRVNSGFGRGLSDKKSGESQVLFETEISRKLFDTLNEDLFQKILVPIQQVLKEGHLEKTEIDEVVLVGGSTRIPRIRQVIQEFFGKDPNTSVDPDLAVVTGVAIQAGIDGGFWPLQVSALEIPNKHLQKTNFN

• Full Name: heat shock protein 70kDa family, member 13
• Calculated Molecular Weight: 471 aa, 52 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC036370
• Gene Symbol: HSPA13
• Gene ID (NCBI): 6782
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P48723
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

HSPA13 (Heat shock 70 kDa protein 13), also known as STCH (the stress 70 protein chaperone), is a member of the Hsp70 family of ATPase "stress" or "heat shock" proteins. Human STCH encodes a 60 kDa protein that is highly enriched in the ER. Recently it has been reported that overexpression of the HSPA13 gene reduces prion disease incubation time in mice.