HSPC159 Polyclonal antibody

• 

  WB analysis using 16708-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16708-1-AP (HSPC159 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 16708-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16708-1-AP (HSPC159 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human hepatocirrhosis using 16708-1-AP

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis tissue slide using 16708-1-AP (HSPC159 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human hepatocirrhosis using 16708-1-AP

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis tissue slide using 16708-1-AP (HSPC159 Antibody) at dilution of 1:50 (under 40x lens).

HSPC159 Polyclonal Antibody for WB, ELISA

Cat No. 16708-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig

Applications

WB, ELISA

Synonyms

galectin related protein, Galectin-like protein, Galectin-related protein, GRP, Lectin galactoside-binding-like protein

---

Tested Applications

• Positive WB detected in: mouse brain tissue, pig brain tissue, rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16708-1-AP targets HSPC159 in WB, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10109

  Product name: Recombinant human HSPC159 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-172 aa of BC062691

  Sequence: MAGSVADSDAVVKLDDGHLNNSLSSPVQADVYFPRLIVPFCGHIKGGMRPGKKVLVMGIVDLNPESFAISLTCGDSEDPPADVAIELKAVFTDRQLLRNSCISGERGEEQSAIPYFPFIPDQPFRVEILCEHPRFRVFVDGHQLFDFYHRIQTLSAIDTIKINGDLQITKLG

• Full Name: galectin-related protein
• Calculated Molecular Weight: 172 aa, 19 kDa
• Observed Molecular Weight: 20 kDa, 27 kDa
• GenBank Accession Number: BC062691
• Gene Symbol: HSPC159
• Gene ID (NCBI): 29094
• RRID: AB_3085506
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q3ZCW2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HSPC159 is a novel human galectin‐related protein (also known as GRP) that is mapped to human chromosome 2p13. The HSPC159 gene was originally deduced by partial sequence alignment and confirmed by a full‐length sequence for an mRNA isolated from CD34+ hematopoietic stem cells.