TIP30 Polyclonal antibody

• 

  WB analysis of HeLa using 10251-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 10251-1-AP (TIP30 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of SW 1990 using 10251-1-AP

  SW 1990 cells were subjected to SDS PAGE followed by western blot with 10251-1-AP (TIP30 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver using 10251-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 10251-1-AP (TIP30 Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human liver using 10251-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 10251-1-AP (TIP30 Antibody) at dilution of 1:200 (under 40x lens).

• 

  IHC staining of human liver cancer using 10251-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 10251-1-AP (TIP30 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 10251-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 10251-1-AP (TIP30 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

TIP30 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 10251-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, ELISA

Synonyms

HTATIP2, 30 kDa HIV-1 TAT-interacting protein, CC3, EC:1.1.1.-, HIV-1 TAT-interactive protein 2

---

Tested Applications

• Positive WB detected in: HeLa cells, SW 1990 cells
• Positive IHC detected in: human liver tissue, human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

10251-1-AP targets TIP30 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0353

  Product name: Recombinant human TIP30 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 82-276 aa of BC002439

  Sequence: TLIGRRKLTFDEEAYKNVNQEVVDFEKLDDYASAFQGHDVGFCCLGTTRGKAGAEGFVRVDRDYVLKSAELAKAGGCKHFNLLSSKGADKSSNFLYLQVKGEVEAKVEELKFDRYSVFRPGVLLCDRQESRPGEWLVRKFFGSLPDSWARGHSVPVVTVVRAMLNNVVRPRDKQMELLENKAIHDLGKAHGSLKP

• Full Name: HIV-1 Tat interactive protein 2, 30kDa
• Calculated Molecular Weight: 27 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC002439
• Gene Symbol: TIP30
• Gene ID (NCBI): 10553
• RRID: AB_2279817
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BUP3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TIP30/CC3 was first identified and characterized as a "candidate" tumor-suppressor gene in 1997. TIP30 is involved in the control of cell apoptosis, growth, metastasis, angiogenesis, DNA repair, and tumor cell metabolism.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Front Cell Dev Biol; Role of GRK2 in Trophoblast Necroptosis and Spiral Artery Remodeling: Implications for Preeclampsia Pathogenesis.; Authors - Zi Lv