TIP30 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TIP30 Polyclonal antibody (10251-1-AP)

TIP30 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 10251-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

HTATIP2, 30 kDa HIV-1 TAT-interacting protein, CC3, EC:1.1.1.-, HIV-1 TAT-interactive protein 2

• 

  WB analysis using 10251-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10251-1-AP (TIP30 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of SW 1990 using 10251-1-AP

  SW 1990 cells were subjected to SDS PAGE followed by western blot with 10251-1-AP (TIP30 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 10251-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 10251-1-AP (TIP30 Antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 10251-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 10251-1-AP (TIP30 Antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 10251-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 10251-1-AP (TIP30 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 10251-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 10251-1-AP (TIP30 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 10251-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using TIP30 antibody (10251-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for TIP30 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: BxPC-3 cells, SW 1990 cells, HeLa cells
• Positive IHC detected in: human liver tissue, human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10251-1-AP targets TIP30 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0353

  Product name: Recombinant human TIP30 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 82-276 aa of BC002439

  Sequence: TLIGRRKLTFDEEAYKNVNQEVVDFEKLDDYASAFQGHDVGFCCLGTTRGKAGAEGFVRVDRDYVLKSAELAKAGGCKHFNLLSSKGADKSSNFLYLQVKGEVEAKVEELKFDRYSVFRPGVLLCDRQESRPGEWLVRKFFGSLPDSWARGHSVPVVTVVRAMLNNVVRPRDKQMELLENKAIHDLGKAHGSLKP

• Full Name: HIV-1 Tat interactive protein 2, 30kDa
• Calculated Molecular Weight: 27 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC002439
• Gene Symbol: TIP30
• Gene ID (NCBI): 10553
• RRID: AB_2279817
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BUP3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TIP30/CC3 was first identified and characterized as a "candidate" tumor-suppressor gene in 1997. TIP30 is involved in the control of cell apoptosis, growth, metastasis, angiogenesis, DNA repair, and tumor cell metabolism.

Publications

What published studies show

TIP30 Polyclonal antibody (Cat# 10251-1-AP) has a total of 2 citations. These citations appear in Nature Communications (Impact Factor 18.1) and Frontiers in Cell and Developmental Biology (Impact Factor 5.3). The associated research fields include lipid metabolism and remyelination through the UBE3A/ABCA1 pathway in foam cell formation, as well as preeclampsia pathogenesis involving GRK2-mediated trophoblast necroptosis and spiral artery remodeling.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Commun; UBE3A promotes foam cell formation and counters remyelination by targeting ABCA1 for proteasomal degradation; Authors - Melanie Loix
mouse	WB	Front Cell Dev Biol; Role of GRK2 in Trophoblast Necroptosis and Spiral Artery Remodeling: Implications for Preeclampsia Pathogenesis.; Authors - Zi Lv