HTR2B Recombinant monoclonal antibody

• 

  WB analysis using 87277-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87277-1-RR (HTR2B antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

HTR2B Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87277-1-RR

Clone No.252478D4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

5 HT 2B, 5 HT(2B), 5 HT2B, 5-HT2B, 5-HT-2B

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, HT-29 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87277-1-RR targets HTR2B in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag24007

  Product name: Recombinant human HTR2B protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-56 aa of BC063123

  Sequence: MALSYRVSELQSTIPEHILQSTFVHVISSNWSGLQTESIPEEMKQIVEEQGNKLHW

• Full Name: 5-hydroxytryptamine (serotonin) receptor 2B
• Calculated Molecular Weight: 54 kDa
• Observed Molecular Weight: 57 kDa
• GenBank Accession Number: BC063123
• Gene Symbol: HTR2B
• Gene ID (NCBI): 3357
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P41595
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The serotonin (5-HT) gene has been implicated in the development of personality traits or temperament predisposition. HTR2B(serotonin receptor 2B) has been shown that 3,4-methylene-dioxymethamphetamine, commonly referred to as the drug ecstasy, selectively binds and activates 5-HT2B receptors to induce serotonin release in mouse raphe nuclei, which leads to dopamine release in the nucleus accumbens and ventral tegmentum (PMID:23774082). Moreover, One of the most reliable predictive markers of UM (Uveal melanoma) at risk of evolving toward the formation of liver lesions is an abnormally elevated level of expression of the transcript encoding the HTR2B (PMID:31002821).