HTRA3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• HTRA3 Polyclonal antibody (31369-1-AP)

• 

  WB analysis using 31369-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31369-1-AP (HTRA3 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

HTRA3 Polyclonal Antibody for WB, ELISA

Cat No. 31369-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

Tasp, PRSP

---

Tested Applications

• Positive WB detected in: SK-N-SH cells, Saos-2 cells, U-87 MG cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:16000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31369-1-AP targets HTRA3 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35448

  Product name: Recombinant human HTRA3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 337-453 aa of NM_053044.4

  Sequence: ITRFLTEFQDKQIKDWKKRFIGIRMRTITPSLVDELKASNPDFPEVSSGIYVQEVAPNSPSQRGGIQDGDIIVKVNGRPLVDSSELQEAVLTESPLLLEVRRGNDDLLFSIAPEVVM

• Full Name: HtrA serine peptidase 3
• Calculated Molecular Weight: 49kDa，453aa
• Observed Molecular Weight: 49 kDa
• GenBank Accession Number: NM_053044.4
• Gene Symbol: HTRA3
• Gene ID (NCBI): 94031
• RRID: AB_3742421
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P83110
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HTRA3 is one of the four members of the HtrA family proteins, with a secreted multidomain and serine protease activity, which plays an important role in cellular stress response, protein homeostasis, and apoptosis. HTRA3 is highly expressed in the decidual cells in the late secretory phase of the menstrual cycle and throughout pregnancy, and in most trophoblast cell types, apart from the invading interstitial trophoblast during the first trimester. HTRA3 and its family members are down-regulated in several cancers and are proposed as tumor suppressors (PMID: 21321049, 22229724).