HTRA4 Polyclonal antibody

HTRA4 Polyclonal Antibody for WB, ELISA
Cat No. 14095-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

HtrA serine peptidase 4, HTRA4, Probable serine protease HTRA4

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman placenta tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

14095-1-AP targets HTRA4 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag5227

Product name: Recombinant human HTRA4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 128-476 aa of BC057765

Sequence: ALRAENRAARRLGKVPAVPVQWGNCGDTGTRSAGPLRRNYNFIAAVVEKVAPSVVHVQLWGRLLHGSRLVPVYSGSGFIVSEDGLIITNAHVVRNQQWIEVVLQNGARYEAVVKDIDLKLDLAVIKIESNAELPVLMLGRSSDLRAGEFVVALGSPFSLQNTATAGIVSTKQRGGKELGMKDSDMDYVQIDATINYGNSGGPLVNLDGDVIGVNSLRVTDGISFAIPSDRVRQFLAEYHEHQMKGKAFSNKKYLGLQMLSLTVPLSEELKMHYPDFPDVSSGVYVCKVFEGTAAQSSGLRDHDVIVNINGKPITTTTDVVKALDSDSLSMAVLRGKDNLLLTVIPETIN

Predict reactive species
Full Name HtrA serine peptidase 4
Calculated Molecular Weight 476 aa, 51 kDa
Observed Molecular Weight 51 kDa
GenBank Accession NumberBC057765
Gene Symbol HTRA4
Gene ID (NCBI) 203100
RRIDAB_10859093
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP83105
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
WB protocol for HTRA4 antibody 14095-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...