HUWE1 Recombinant monoclonal antibody, PBS Only

HUWE1 Uni-rAb® Recombinant Antibody for WB, IHC, FC (Intra), Indirect ELISA
Cat No. 85177-3-PBS
Clone No.242702F10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, FC (Intra), Indirect ELISA

242702F10, ARF binding protein 1, ARF BP1, ARF-binding protein 1, ARF-BP1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85177-3-PBS targets HUWE1 in WB, IHC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag13763

Product name: Recombinant human HUWE1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 3983-4374 aa of BC002602

Sequence: AVLVDYIRVLDFDVKRKYFRQELERLDEGLRKEDMAVHVLRDHVFEDSYRELHRKSPEEMKNRLYIVFEGEEGQDAGGLLREWYMIISREMFNPMYALFRTSPGDRVTYTINPSSHCNPNHLSYFKFVGRIVAKAVYDNRLLECYFTRSFYKHILGKSVRYTDMESEDYHFYQGLVYLLENDVSTLGYDLTFSTEVQEFGVCEVRDLKPNGANILVTEENKKEYVHLVCQMRMTGAIRKQLAAFLEGFYEIIPKRLISIFTEQELELLISGLPTIDIDDLKSNTEYHKYQSNSIQIQWFWRALRSFDQADRAKFLQFVTGTSKVPLQGFAALEGMNGIQKFQIHRDDRSTDRLPSAHTCFNQLDLPAYESFEKLRHMLLLAIQECSEGFGLA

Predict reactive species
Full Name HECT, UBA and WWE domain containing 1
Calculated Molecular Weight 437 aa, 482 kDa
Observed Molecular Weight482 kDa
GenBank Accession NumberBC002602
Gene Symbol HUWE1
Gene ID (NCBI) 10075
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ7Z6Z7
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

HUWE1 encodes a HECT domain ubiquitin ligase which is a large protein (500 kDa) has attracted considerable interest because several and quite disparate substrates have been assigned to this E3. It has a role in regulating Berg-mann glia differentiation and this ubiquitin ligase orchestrates the programming of the neural progenitors that give rise to neurons and glia in the cerebellum. HUWE1 is essential for proliferation of a subset of tumor cells, and negative regulator of TP53 during the colorectal carcinoma progression through the ubiquitination pathway mediated by the HECT domain (PMID:15567145). HUWE1 plays a critical role in lung cancer and increased HUWE1 expression is significantly associated with worse prognosis which suggest that HUWE1 might be a potential target for lung cancer therapy (PMID: 30026863).

Loading...
||
New chat Able
正在加载,请稍候...