Anti-Mouse HVEM/TNFRSF14 Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• Anti-Mouse HVEM/TNFRSF14 Rabbit Recombinant Antibody (98781-2-RR)

HVEM/TNFRSF14 Uni-rAb^® Recombinant Antibody for FC

Cat No. 98781-2-RR

Clone No.252718B3

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Synonyms

CD270, Herpes virus entry mediator A, Herpesvirus entry mediator A, HveA, hvem

• 

  FC experiment of mouse splenocytes using 98781-2-RR

  1x10^6 mouse splenocytes were surface stained with 0.25 ug Anti-Mouse HVEM/TNFRSF14 Rabbit RecAb (98781-2-RR, Clone: 252718B3) or 0.25 ug Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of mouse splenocytes using 98781-2-RR

  1x10^6 mouse splenocytes were surface stained with 0.25 ug Anti-Mouse HVEM/TNFRSF14 Rabbit RecAb (98781-2-RR, Clone: 252718B3) (red) or 0.25 ug Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive FC detected in: mouse splenocytes

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

98781-2-RR targets HVEM/TNFRSF14 in FC applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3145

  Product name: Recombinant mouse Tnfrsf14 protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 39-207 aa of NM_178931.2

  Sequence: QPSCRQEEFLVGDECCPMCNPGYHVKQVCSEHTGTVCAPCPPQTYTAHANGLSKCLPCGVCDPDMGLLTWQECSSWKDTVCRCIPGYFCENQDGSHCSTCLQHTTCPPGQRVEKRGTHDQDTVCADCLTGTFSLGGTQEECLPWTNCSAFQQEVRRGTNSTDTTCSSQV

• Full Name: tumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator)
• Calculated Molecular Weight: 30 kDa
• GenBank Accession Number: NM_178931.2
• Gene Symbol: Tnfrsf14
• Gene ID (NCBI): 230979
• RRID: AB_3746345
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q80WM9
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Background Information

The mammalian tumor necrosis factor receptor (TNFR) family consists of 10 cell-surface proteins that regulate development and homeostasis of the immune system. Member 14 of TNFR (TNFRSF14, also named as TR2, ATAR, HVEA, HVEM, LIGHTR) was also identified as a mediator of herpesvirus entry into mammalian cells. The cytoplasmic region of TNFRSF14 bound to several members of the TNFR-associated factor (TRAF) family, namely TRAF1, TRAF2, TRAF3, and TRAF5. Transient transfection into human 293 cells caused marked activation of nuclear factor- B (NF- B), a transcriptional regulator of multiple immunomodulatory and inflammatory genes.