HYI Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• HYI Polyclonal antibody, PBS Only (16390-1-PBS)

• 

  WB analysis using 16390-1-AP (same clone as 16390-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 16390-1-AP (HYI antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16390-1-PBS in a different storage buffer formulation.

HYI Polyclonal Antibody for WB, Indirect ELISA

Cat No. 16390-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

16390-1-PBS targets HYI in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9457

  Product name: Recombinant human HYI protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-174 aa of BC019041

  Sequence: MGLGAVPGRQAAFREGLEQAVRYAKALGCPRIHLMAGRVPQGADRIAVKAEMEAVFLENLRHAAGVLAQEDLVGLLEPINTRITDPQYFLDTPQQAAAILQKVGRPNLQLQMDIFHWQIMDGNLTGNIREFLPIVGHVQVAQVPGRGEPSSPGELNFPYLFQLLEDEGYKGFVG

• Full Name: hydroxypyruvate isomerase homolog (E. coli)
• Calculated Molecular Weight: 217aa,24 kDa; 174aa,19 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC019041
• Gene Symbol: HYI
• Gene ID (NCBI): 81888
• RRID: AB_3669242
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5T013
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.