Haptoglobin Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Haptoglobin Polyclonal antibody, PBS Only (16665-1-PBS)

• 

  WB analysis using 16665-1-AP (same clone as 16665-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 16665-1-AP (Haptoglobin antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16665-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 16665-1-AP (same clone as 16665-1-PBS)

  Human plasma were subjected to SDS PAGE followed by western blot with 16665-1-AP (Haptoglobin antibody) at dilution of 1:18000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16665-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 16665-1-AP (same clone as 16665-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 16665-1-AP (Haptoglobin antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16665-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 16665-1-AP (same clone as 16665-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 16665-1-AP (Haptoglobin antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16665-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 16665-1-AP (same clone as 16665-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 16665-1-AP (Haptoglobin antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16665-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 16665-1-AP (same clone as 16665-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 16665-1-AP (Haptoglobin antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16665-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 16665-1-AP (same clone as 16665-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 16665-1-AP (Haptoglobin antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16665-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 16665-1-AP (same clone as 16665-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 16665-1-AP (Haptoglobin antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16665-1-PBS in a different storage buffer formulation.

Haptoglobin Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 16665-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

HP, BP, HAPT, HP2 ALPHA 2, HPA1S

---

Product Information

16665-1-PBS targets Haptoglobin in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10143

  Product name: Recombinant human HP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 179-406 aa of BC058031

  Sequence: MVSHHNLTTGATLINEQWLLTTAKNLFLNHSENATAKDIAPTLTLYVGKKQLVEIEKVVLHPNYSQVDIGLIKLKQKVSVNERVMPICLPSKDYAEVGRVGYVSGWGRNANFKFTDHLKYVMLPVADQDQCIRHYEGSTVPEKKTPKSPVGVQPILNEHTFCAGMSKYQEDTCYGDAGSAFAVHDLEEDTWYATGILSFDKSCAVAEYGVYVKVTSIQDWVQKTIAEN

• Full Name: haptoglobin
• Calculated Molecular Weight: 281aa,31 kDa; 228aa,25 kDa
• Observed Molecular Weight: 42 kDa
• GenBank Accession Number: BC058031
• Gene Symbol: HP
• Gene ID (NCBI): 3240
• RRID: AB_1939524
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P00738
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

HP(Haptoglobin) is also named as zonulin and belongs to the peptidase S1 family. HP, a plasma glycoprotein that binds free hemoglobin, has a tetrameric structure of 2 alpha(16 kDa and 9 kDa) and 2 beta(40 kDa) polypeptides that are covalently associated by disulfide bonds. In most species, apart from ruminants, Hp has a molecular mass of 100 kDa, consisting of two subunits of 40 kDa and two subunits of 9 kDa, although in a few species, such as man, genetic variant of Hp forms polymers of higher mass(PMID:2361363). Recent studies of haptoglobin show that certain oligosaccharide structures predominate in different diseases. For example, a highly-fucosylated structure is found in breast cancer and ovarian cancer, highly-sialylated structures in Crohn's disease and highly branched structures in alcoholic liver disease and fucosylated haptoglobin is a good serum marker for pancreatic cancer.(PMID:16385567).